UniProt ID | VA723_ARATH | |
---|---|---|
UniProt AC | Q8VY69 | |
Protein Name | Vesicle-associated membrane protein 723 {ECO:0000303|PubMed:11115874} | |
Gene Name | VAMP723 {ECO:0000303|PubMed:11115874} | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 217 | |
Subcellular Localization |
Endoplasmic reticulum membrane Single-pass type IV membrane protein . |
|
Protein Description | Involved in the targeting and/or fusion of transport vesicles to their target membrane.. | |
Protein Sequence | MAQQSLFYSFIARGTVILVEFTDFKGNFTSVAAQYLENLPSSNNKFTYNCDGHTFNDLVENGFTYCVVAVDSAGREIPMAFLERVKEDFYKRYGGEKAATDQANSLNKEFGSNLKEHMQYCMDHPDEISNLAKAKAQVSEVKSLMMENIEKVLARGVICEMLGSSESQPQAFYIKRTQMKRKKWFQNMKIKLIVLAIIIALILIIILSVCGGFNCGK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
139 | Phosphorylation | AKAKAQVSEVKSLMM HHHHHHHHHHHHHHH | 25.29 | 30407730 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VA723_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VA723_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VA723_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
HSDD3_ARATH | AT2G43420 | physical | 24833385 | |
DERL1_ARATH | DER1 | physical | 24833385 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...