TRXH5_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TRXH5_ARATH
• UniProt AC: Q39241
• Protein Name: Thioredoxin H5
• Gene Name: TRX5
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 118
• Subcellular Localization: Cytoplasm.
• Protein Description: Thiol-disulfide oxidoreductase involved in response to pathogens and oxidative stresses. Required for the response to victorin, a phytotoxin which induces programmed cell death in sensitive plants. Possesses insulin disulfide bonds reducing activity..
• Protein Sequence: MAGEGEVIACHTLEVWNEKVKDANESKKLIVIDFTASWCPPCRFIAPVFAEMAKKFTNVVFFKIDVDELQAVAQEFKVEAMPTFVFMKEGNIIDRVVGAAKDEINEKLMKHGGLVASA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MAGEGEVIA ------CCCCCCEEE	25.41	22223895

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TRXH5_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TRXH5_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TRXH5_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
BOI_ARATH	RING	physical	21798944
BCA4_ARATH	BCA4	physical	21798944
NPR1_ARATH	NPR1	physical	25201412
ALBU_BOVIN	ALB	physical	25201412

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.