| UniProt ID | BCA4_ARATH | |
|---|---|---|
| UniProt AC | Q94CE4 | |
| Protein Name | Beta carbonic anhydrase 4 {ECO:0000303|PubMed:17407539} | |
| Gene Name | BCA4 {ECO:0000303|PubMed:17407539} | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 280 | |
| Subcellular Localization |
Cell membrane Peripheral membrane protein . |
|
| Protein Description | Reversible hydration of carbon dioxide. Together with BCA1, involved in the CO(2) signaling pathway which controls gas-exchange between plants and the atmosphere by modulating stomatal development and movements. Promotes water use efficiency.. | |
| Protein Sequence | MAPAFGKCFMFCCAKTSPEKDEMATESYEAAIKGLNDLLSTKADLGNVAAAKIKALTAELKELDSSNSDAIERIKTGFTQFKTEKYLKNSTLFNHLAKTQTPKFLVFACSDSRVCPSHILNFQPGEAFVVRNIANMVPPFDQKRHSGVGAAVEYAVVHLKVENILVIGHSCCGGIKGLMSIEDDAAPTQSDFIENWVKIGASARNKIKEEHKDLSYDDQCNKCEKEAVNVSLGNLLSYPFVRAEVVKNTLAIRGGHYNFVKGTFDLWELDFKTTPAFAFS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 (in isoform 2) | Acetylation | - | 22223895 | ||
| 16 | Phosphorylation | FMFCCAKTSPEKDEM EEHHCCCCCHHHHHH | 23111157 | ||
| 17 | Phosphorylation | MFCCAKTSPEKDEMA EHHCCCCCHHHHHHC | 25561503 | ||
| 57 | Phosphorylation | AAKIKALTAELKELD HHHHHHHHHHHHHHC | - | ||
| 65 | Phosphorylation | AELKELDSSNSDAIE HHHHHHCCCCHHHHH | 19376835 | ||
| 66 | Phosphorylation | ELKELDSSNSDAIER HHHHHCCCCHHHHHH | 24243849 | ||
| 68 | Phosphorylation | KELDSSNSDAIERIK HHHCCCCHHHHHHHH | 30291188 | ||
| 90 | Phosphorylation | TEKYLKNSTLFNHLA CHHHHCCCHHHHHHH | 25561503 | ||
| 91 | Phosphorylation | EKYLKNSTLFNHLAK HHHHCCCHHHHHHHC | 25561503 | ||
| 117 | Phosphorylation | SDSRVCPSHILNFQP CCCCCCCHHHHCCCC | - | ||
| 223 | S-nitrosylation | YDDQCNKCEKEAVNV HHHCCCHHHHHHHCC | - | ||
| 237 | Phosphorylation | VSLGNLLSYPFVRAE CCHHHHHHCHHHHHH | 29654922 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BCA4_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BCA4_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BCA4_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TRXH3_ARATH | TRX3 | physical | 21798944 | |
| IMDH1_ARATH | AT1G79470 | physical | 21798944 | |
| BCA4_ARATH | BCA4 | physical | 21798944 | |
| GRS14_ARATH | CXIP1 | physical | 21798944 | |
| P2SAF_ARATH | HCF136 | physical | 21798944 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
