UniProt ID | TRXH3_ARATH | |
---|---|---|
UniProt AC | Q42403 | |
Protein Name | Thioredoxin H3 | |
Gene Name | TRX3 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 118 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | Thiol-disulfide oxidoreductase that possesses disulfide reductase and insulin disulfide bonds reducing activities. Heat shock causes oligomerization and formation of high molecular weight (HMW) complexes with concomitant functional switching from a disulfide reductase to chaperone.. | |
Protein Sequence | MAAEGEVIACHTVEDWTEKLKAANESKKLIVIDFTATWCPPCRFIAPVFADLAKKHLDVVFFKVDVDELNTVAEEFKVQAMPTFIFMKEGEIKETVVGAAKEEIIANLEKHKTVVAAA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAAEGEVIA ------CCCCCCEEE | 17.77 | 22223895 | |
81 | Sulfoxidation | EEFKVQAMPTFIFMK HHHCCCCCCEEEEEE | 1.47 | 25693801 | |
87 | Sulfoxidation | AMPTFIFMKEGEIKE CCCEEEEEECCCEEE | 3.10 | 25693801 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TRXH3_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TRXH3_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TRXH3_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of TRXH3_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...