TRXH3_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TRXH3_ARATH
• UniProt AC: Q42403
• Protein Name: Thioredoxin H3
• Gene Name: TRX3
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 118
• Subcellular Localization: Cytoplasm .
• Protein Description: Thiol-disulfide oxidoreductase that possesses disulfide reductase and insulin disulfide bonds reducing activities. Heat shock causes oligomerization and formation of high molecular weight (HMW) complexes with concomitant functional switching from a disulfide reductase to chaperone..
• Protein Sequence: MAAEGEVIACHTVEDWTEKLKAANESKKLIVIDFTATWCPPCRFIAPVFADLAKKHLDVVFFKVDVDELNTVAEEFKVQAMPTFIFMKEGEIKETVVGAAKEEIIANLEKHKTVVAAA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MAAEGEVIA ------CCCCCCEEE	17.77	22223895
81	Sulfoxidation	EEFKVQAMPTFIFMK HHHCCCCCCEEEEEE	1.47	25693801
87	Sulfoxidation	AMPTFIFMKEGEIKE CCCEEEEEECCCEEE	3.10	25693801

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TRXH3_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TRXH3_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TRXH3_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of TRXH3_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.