dbPTM

SPCS1_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SPCS1_ARATH
UniProt AC	Q944J0
Protein Name	Probable signal peptidase complex subunit 1
Gene Name	At2g22425
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	92
Subcellular Localization	Membrane Multi-pass membrane protein . Microsome membrane Multi-pass membrane protein . Endoplasmic reticulum membrane Multi-pass membrane protein .
Protein Description	Microsomal signal peptidase is a membrane-bound endoproteinase that removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum..
Protein Sequence	MDWQGQKLVEQLMQILLVISGVVAVVVGYTTESFRTMMLIYAGGVVLTTLVTVPNWPFYNLHPLKWLDPSEAEKHPKPEVVSVASKKKFSKK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of SPCS1_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SPCS1_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SPCS1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SPCS1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of SPCS1_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SPCS1_ARATH

Related Literatures of Post-Translational Modification