UniProt ID | BETL2_ARATH | |
---|---|---|
UniProt AC | Q8L9S0 | |
Protein Name | Bet1-like protein At1g29060 | |
Gene Name | At1g29060 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 134 | |
Subcellular Localization |
Golgi apparatus membrane Single-pass type IV membrane protein. Endoplasmic reticulum membrane Single-pass type IV membrane protein. |
|
Protein Description | Required for vesicular transport from the ER to the Golgi complex. Functions as a SNARE associated with ER-derived vesicles (By similarity).. | |
Protein Sequence | MASNRGAGGSLYGGADPYRSREGLSTRNASGSEEIQLRIDPMHSDLDDEILGLHGQVRQLKNIAQEIGSEAKSQRDFLDELQMTLIRAQAGVKNNIRKLNLSIIRSGNNHIMHVVLFALLLFFILYMWSKMFKR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BETL2_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BETL2_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BETL2_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of BETL2_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...