BETL2_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: BETL2_ARATH
• UniProt AC: Q8L9S0
• Protein Name: Bet1-like protein At1g29060
• Gene Name: At1g29060
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 134
• Subcellular Localization: Golgi apparatus membrane; Single-pass type IV membrane protein. Endoplasmic reticulum membrane; Single-pass type IV membrane protein.
• Protein Description: Required for vesicular transport from the ER to the Golgi complex. Functions as a SNARE associated with ER-derived vesicles (By similarity)..
• Protein Sequence: MASNRGAGGSLYGGADPYRSREGLSTRNASGSEEIQLRIDPMHSDLDDEILGLHGQVRQLKNIAQEIGSEAKSQRDFLDELQMTLIRAQAGVKNNIRKLNLSIIRSGNNHIMHVVLFALLLFFILYMWSKMFKR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
30	Phosphorylation	GLSTRNASGSEEIQL CCCCCCCCCCCCEEE	46.53	27288362
32	Phosphorylation	STRNASGSEEIQLRI CCCCCCCCCCEEEEE	29.57	27288362

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of BETL2_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of BETL2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of BETL2_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of BETL2_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.