UniProt ID | JAL20_ARATH | |
---|---|---|
UniProt AC | O80998 | |
Protein Name | Jacalin-related lectin 20 | |
Gene Name | JAL20 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 449 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MAQRLEAKGGKGGNQWDDGADHENVTKIHVRGGLEGIQFIKFEYVKAGQTVVGPIHGVSGKGFTQTFEINHLNGEHVVSVKGCYDNISGVIQALQFETNQRSSEVMGYDDTGTKFTLEISGNKITGFHGSADANLKSLGAYFTPPPPIKQEYQGGTGGSPWDHGIYTGIRKVYVTFSPVSISHIKVDYDKDGKVETRQDGDMLGENRVQGQPNEFVVDYPYEYITSIEVTCDKVSGNTNRVRSLSFKTSKDRTSPTYGRKSERTFVFESKGRALVGLHGRCCWAIDALGAHFGAPPIPPPPPTEKLQGSGGDGGESWDDGAFDGVRKIYVGQGENGIASVKFVYDKNNQLVLGEEHGKHTLLGYEEFELDYPSEYITAVEGYYDKVFGSESSVIVMLKFKTNKRTSPPYGMDAGVSFILGKEGHKVVGFHGKASPELYQIGVTVAPITK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of JAL20_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of JAL20_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of JAL20_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SSY2_ARATH | SS2 | physical | 21798944 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...