HIR3_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: HIR3_ARATH
• UniProt AC: Q9SRH6
• Protein Name: Hypersensitive-induced response protein 3
• Gene Name: HIR3
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 285
• Subcellular Localization: Cell membrane ; Lipid-anchor ; Cytoplasmic side .
• Protein Sequence: MGNLFCCVLVKQSDVAVKERFGKFQKVLNPGLQFVPWVIGDYVAGTLTLRLQQLDVQCETKTKDNVFVTVVASIQYRVLADKASDAFYRLSNPTTQIKAYVFDVIRACVPKLNLDDVFEQKNEIAKSVEEELDKAMTAYGYEILQTLIIDIEPDQQVKRAMNEINAAARMRVAASEKAEAEKIIQIKRAEGEAESKYLSGLGIARQRQAIVDGLRDSVLGFAGNVPGTSAKDVLDMVMMTQYFDTMRDIGATSKSSAVFIPHGPGAVSDVAAQIRNGLLQANNAS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Myristoylation	------MGNLFCCVL ------CCCEEEEEE	39.28	-
60	Phosphorylation	QLDVQCETKTKDNVF ECEEECEECCCCCEE	52.20	19880383
199	Phosphorylation	EAESKYLSGLGIARQ HHHHHHHHCCCCHHH	28.96	17317660
229	Phosphorylation	AGNVPGTSAKDVLDM CCCCCCCCHHHHHHH	38.96	26811356
256	Phosphorylation	IGATSKSSAVFIPHG CCCCCCCCEEEECCC	31.99	26811356

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of HIR3_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of HIR3_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of HIR3_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of HIR3_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.