UniProt ID | HIR3_ARATH | |
---|---|---|
UniProt AC | Q9SRH6 | |
Protein Name | Hypersensitive-induced response protein 3 | |
Gene Name | HIR3 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 285 | |
Subcellular Localization |
Cell membrane Lipid-anchor Cytoplasmic side . |
|
Protein Description | ||
Protein Sequence | MGNLFCCVLVKQSDVAVKERFGKFQKVLNPGLQFVPWVIGDYVAGTLTLRLQQLDVQCETKTKDNVFVTVVASIQYRVLADKASDAFYRLSNPTTQIKAYVFDVIRACVPKLNLDDVFEQKNEIAKSVEEELDKAMTAYGYEILQTLIIDIEPDQQVKRAMNEINAAARMRVAASEKAEAEKIIQIKRAEGEAESKYLSGLGIARQRQAIVDGLRDSVLGFAGNVPGTSAKDVLDMVMMTQYFDTMRDIGATSKSSAVFIPHGPGAVSDVAAQIRNGLLQANNAS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Myristoylation | ------MGNLFCCVL ------CCCEEEEEE | 39.28 | - | |
60 | Phosphorylation | QLDVQCETKTKDNVF ECEEECEECCCCCEE | 52.20 | 19880383 | |
199 | Phosphorylation | EAESKYLSGLGIARQ HHHHHHHHCCCCHHH | 28.96 | 17317660 | |
229 | Phosphorylation | AGNVPGTSAKDVLDM CCCCCCCCHHHHHHH | 38.96 | 26811356 | |
256 | Phosphorylation | IGATSKSSAVFIPHG CCCCCCCCEEEECCC | 31.99 | 26811356 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HIR3_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HIR3_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HIR3_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of HIR3_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...