| UniProt ID | TBB2_ARATH | |
|---|---|---|
| UniProt AC | Q56YW9 | |
| Protein Name | Tubulin beta-2 chain | |
| Gene Name | TUBB2 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 450 | |
| Subcellular Localization | Cytoplasm, cytoskeleton. | |
| Protein Description | Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain.. | |
| Protein Sequence | MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYTGDSDLQLERINVYYNEASCGRFVPRAVLMDLEPGTMDSLRSGPYGQTFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLNHLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRSLTVPELTQQMWDSKNMMCAADPRHGRYLTASAMFRGKMSTKEVDEQMLNVQNKNSSYFVEWIPNNVKSTVCDIPPTGLKMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEEGDYEDEEEGEYQQEEEY | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 75 | Phosphorylation | LEPGTMDSLRSGPYG CCCCCHHHHHCCCCC | 18.17 | 19880383 | |
| 138 | Phosphorylation | QGFQVCHSLGGGTGS CCEEEEHHCCCCCCC | 24.47 | 25368622 | |
| 143 | Phosphorylation | CHSLGGGTGSGMGTL EHHCCCCCCCCHHHH | 31.30 | 25368622 | |
| 145 | Phosphorylation | SLGGGTGSGMGTLLI HCCCCCCCCHHHHHH | 25.99 | 25368622 | |
| 290 | Phosphorylation | SLTVPELTQQMWDSK HCCHHHHHHHHHHCC | 18.32 | 19880383 | |
| 301 | S-nitrosylation | WDSKNMMCAADPRHG HHCCCCEECCCCCCC | 1.64 | 22115780 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TBB2_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TBB2_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TBB2_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of TBB2_ARATH !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
