| UniProt ID | PANE_YEAST | |
|---|---|---|
| UniProt AC | P38787 | |
| Protein Name | 2-dehydropantoate 2-reductase | |
| Gene Name | PAN5 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 379 | |
| Subcellular Localization | ||
| Protein Description | Catalyzes the NADPH-dependent reduction of ketopantoate into pantoic acid.. | |
| Protein Sequence | MTAPHRSTIHILGLGAMGTVLAVDLLRFTNALVVPLFRSQERLAQFQKTNGNNISIRKLYLEGSPIFSYPVEKCECPETFSKKPIDNLVVTTKTYQTKEALAPYLPYINKNTNLILIQNGLGVLELLREEIFTDSKNRPHLFQGVISHGVYQDKAGVFNHAGWAGMKIAKLPWTEEEMIQKKSVVEDDAANNSLVKLLTEPKFAKEFGIEHSTYQEMLFGQLFKFLVNACMNPVTAILDCVNGEMKASCGPVFTSIIDECLQILRVAYRPLFQYHEKYSGNEEYPEMDVNAVLTTDNMVSEVTRIGCDINSRNSSSMRQDTLFLRDIEIEYINGYVVKLADNLNLDPNCCKVNKTIGELATMRLALNRSRSINGDWRKD | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 48 | Ubiquitination | ERLAQFQKTNGNNIS HHHHHHHHHCCCCEE | 45.29 | 23749301 | |
| 48 | Acetylation | ERLAQFQKTNGNNIS HHHHHHHHHCCCCEE | 45.29 | 24489116 | |
| 49 | Phosphorylation | RLAQFQKTNGNNISI HHHHHHHHCCCCEEE | 37.26 | 26447709 | |
| 82 | Ubiquitination | ECPETFSKKPIDNLV CCCCCCCCCCCCEEE | 59.38 | 17644757 | |
| 83 | Ubiquitination | CPETFSKKPIDNLVV CCCCCCCCCCCEEEE | 46.11 | 17644757 | |
| 83 | Acetylation | CPETFSKKPIDNLVV CCCCCCCCCCCEEEE | 46.11 | 24489116 | |
| 93 | Ubiquitination | DNLVVTTKTYQTKEA CEEEEEECCEECHHH | 35.55 | 17644757 | |
| 98 | Acetylation | TTKTYQTKEALAPYL EECCEECHHHHHHHC | 26.01 | 24489116 | |
| 181 | Acetylation | TEEEMIQKKSVVEDD CHHHHHHCCCCCCCH | 35.77 | 24489116 | |
| 182 | Ubiquitination | EEEMIQKKSVVEDDA HHHHHHCCCCCCCHH | 31.91 | 17644757 | |
| 196 | Ubiquitination | AANNSLVKLLTEPKF HHCCHHHHHHHCHHH | 42.97 | 17644757 | |
| 196 | Acetylation | AANNSLVKLLTEPKF HHCCHHHHHHHCHHH | 42.97 | 24489116 | |
| 202 | Acetylation | VKLLTEPKFAKEFGI HHHHHCHHHHHHHCC | 52.28 | 24489116 | |
| 246 | Ubiquitination | DCVNGEMKASCGPVF HHHCCEEHHHCCHHH | 32.61 | 17644757 | |
| 351 | Ubiquitination | NLDPNCCKVNKTIGE CCCCCCCCCCCHHHH | 51.55 | 23749301 | |
| 354 | Ubiquitination | PNCCKVNKTIGELAT CCCCCCCCHHHHHHH | 44.50 | 24961812 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PANE_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PANE_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PANE_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
