UniProt ID | PA1B3_HUMAN | |
---|---|---|
UniProt AC | Q15102 | |
Protein Name | Platelet-activating factor acetylhydrolase IB subunit gamma | |
Gene Name | PAFAH1B3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 231 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | Inactivates paf by removing the acetyl group at the sn-2 position. This is a catalytic subunit. Plays an important role during the development of brain.. | |
Protein Sequence | MSGEENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNFGIGGDGTQHVLWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRQVNELVRAALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRLLAQDQGQGAPLLEPAP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSGEENPAS ------CCCCCCCCC | 55.71 | 19413330 | |
2 | Phosphorylation | ------MSGEENPAS ------CCCCCCCCC | 55.71 | 19413330 | |
9 | Phosphorylation | SGEENPASKPTPVQD CCCCCCCCCCCCCCC | 40.19 | 27732954 | |
10 | Ubiquitination | GEENPASKPTPVQDV CCCCCCCCCCCCCCC | 55.83 | - | |
12 | Phosphorylation | ENPASKPTPVQDVQG CCCCCCCCCCCCCCC | 39.57 | 25159151 | |
25 | Phosphorylation | QGDGRWMSLHHRFVA CCCCCEEEEEEEECC | 20.00 | 28857561 | |
47 | Phosphorylation | EVVFIGDSLVQLMHQ CEEEECHHHHHHHHH | 25.81 | 24076635 | |
63 | Phosphorylation | EIWRELFSPLHALNF HHHHHHHCHHHHHCE | 38.89 | 28985074 | |
184 | Phosphorylation | GFVHSDGTISHHDMY CCCCCCCCCCHHHHH | 25.05 | - | |
191 | Phosphorylation | TISHHDMYDYLHLSR CCCHHHHHHHHHHHH | 13.90 | 27642862 | |
193 | Phosphorylation | SHHDMYDYLHLSRLG CHHHHHHHHHHHHCC | 4.40 | 27642862 | |
210 | Phosphorylation | PVCRALHSLLLRLLA HHHHHHHHHHHHHHH | 22.89 | 23911959 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PA1B3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PA1B3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PA1B3_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...