NFYC_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NFYC_MOUSE
• UniProt AC: P70353
• Protein Name: Nuclear transcription factor Y subunit gamma
• Gene Name: Nfyc
• Organism: Mus musculus (Mouse).
• Sequence Length: 335
• Subcellular Localization: Nucleus.
• Protein Description: Component of the sequence-specific heterotrimeric transcription factor (NF-Y) which specifically recognizes a 5'-CCAAT-3' box motif found in the promoters of its target genes. NF-Y can function as both an activator and a repressor, depending on its interacting cofactors..
• Protein Sequence: MSTEGGFGGTSSSDAQQSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDFLIDIVPRDELKPPKRQEEVRQSVTPAEPVQYYFTLAQQPTAVQVQGQQQGQQTTSSTTTIQPGQIIIAQPQQGQTTPVTMQVGEGQQVQIVQAQPQGQAQQTQSGTGQTMQVMQQIITNTGEIQQIPVQLNAGQLQYIRLAQPVSGTQVVQGQIQTLATNAQQITQTEVQQGQQQFSQFTDGQQLYQIQQVTMPAGQDLAQPMFIQSANQPSDGQTPQVTGD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSTEGGFGG ------CCCCCCCCC	34.86	26643407
3	Phosphorylation	-----MSTEGGFGGT -----CCCCCCCCCC	37.03	26643407
10	Phosphorylation	TEGGFGGTSSSDAQQ CCCCCCCCCCHHHHH	26.30	26643407
11	Phosphorylation	EGGFGGTSSSDAQQS CCCCCCCCCHHHHHH	30.99	26643407
12	Phosphorylation	GGFGGTSSSDAQQSL CCCCCCCCHHHHHHH	31.88	26643407
13	Phosphorylation	GFGGTSSSDAQQSLQ CCCCCCCHHHHHHHH	36.41	26643407
18	Phosphorylation	SSSDAQQSLQSFWPR CCHHHHHHHHHHHHH	19.12	26643407

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NFYC_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NFYC_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NFYC_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
INCE_HUMAN	INCENP	physical	26496610
NFYA_HUMAN	NFYA	physical	26496610
NFYB_HUMAN	NFYB	physical	26496610
RT12_HUMAN	MRPS12	physical	26496610
GLYM_HUMAN	SHMT2	physical	26496610
BRD3_HUMAN	BRD3	physical	26496610
MED7_HUMAN	MED7	physical	26496610
HMGX4_HUMAN	HMGXB4	physical	26496610
ABCF2_HUMAN	ABCF2	physical	26496610
ACTZ_HUMAN	ACTR1A	physical	26496610
HNRPQ_HUMAN	SYNCRIP	physical	26496610
PRS23_HUMAN	PRSS23	physical	26496610
TECT3_HUMAN	TCTN3	physical	26496610
SMAG2_HUMAN	SAMD4B	physical	26496610
BOREA_HUMAN	CDCA8	physical	26496610
BDP1_HUMAN	BDP1	physical	26496610
NKRF_HUMAN	NKRF	physical	26496610
ARV1_HUMAN	ARV1	physical	26496610
RT15_HUMAN	MRPS15	physical	26496610
FXRD2_HUMAN	FOXRED2	physical	26496610
PCGF5_HUMAN	PCGF5	physical	26496610

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.