UniProt ID | NFYC_MOUSE | |
---|---|---|
UniProt AC | P70353 | |
Protein Name | Nuclear transcription factor Y subunit gamma | |
Gene Name | Nfyc | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 335 | |
Subcellular Localization | Nucleus. | |
Protein Description | Component of the sequence-specific heterotrimeric transcription factor (NF-Y) which specifically recognizes a 5'-CCAAT-3' box motif found in the promoters of its target genes. NF-Y can function as both an activator and a repressor, depending on its interacting cofactors.. | |
Protein Sequence | MSTEGGFGGTSSSDAQQSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDFLIDIVPRDELKPPKRQEEVRQSVTPAEPVQYYFTLAQQPTAVQVQGQQQGQQTTSSTTTIQPGQIIIAQPQQGQTTPVTMQVGEGQQVQIVQAQPQGQAQQTQSGTGQTMQVMQQIITNTGEIQQIPVQLNAGQLQYIRLAQPVSGTQVVQGQIQTLATNAQQITQTEVQQGQQQFSQFTDGQQLYQIQQVTMPAGQDLAQPMFIQSANQPSDGQTPQVTGD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSTEGGFGG ------CCCCCCCCC | 34.86 | 26643407 | |
3 | Phosphorylation | -----MSTEGGFGGT -----CCCCCCCCCC | 37.03 | 26643407 | |
10 | Phosphorylation | TEGGFGGTSSSDAQQ CCCCCCCCCCHHHHH | 26.30 | 26643407 | |
11 | Phosphorylation | EGGFGGTSSSDAQQS CCCCCCCCCHHHHHH | 30.99 | 26643407 | |
12 | Phosphorylation | GGFGGTSSSDAQQSL CCCCCCCCHHHHHHH | 31.88 | 26643407 | |
13 | Phosphorylation | GFGGTSSSDAQQSLQ CCCCCCCHHHHHHHH | 36.41 | 26643407 | |
18 | Phosphorylation | SSSDAQQSLQSFWPR CCHHHHHHHHHHHHH | 19.12 | 26643407 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NFYC_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NFYC_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NFYC_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
INCE_HUMAN | INCENP | physical | 26496610 | |
NFYA_HUMAN | NFYA | physical | 26496610 | |
NFYB_HUMAN | NFYB | physical | 26496610 | |
RT12_HUMAN | MRPS12 | physical | 26496610 | |
GLYM_HUMAN | SHMT2 | physical | 26496610 | |
BRD3_HUMAN | BRD3 | physical | 26496610 | |
MED7_HUMAN | MED7 | physical | 26496610 | |
HMGX4_HUMAN | HMGXB4 | physical | 26496610 | |
ABCF2_HUMAN | ABCF2 | physical | 26496610 | |
ACTZ_HUMAN | ACTR1A | physical | 26496610 | |
HNRPQ_HUMAN | SYNCRIP | physical | 26496610 | |
PRS23_HUMAN | PRSS23 | physical | 26496610 | |
TECT3_HUMAN | TCTN3 | physical | 26496610 | |
SMAG2_HUMAN | SAMD4B | physical | 26496610 | |
BOREA_HUMAN | CDCA8 | physical | 26496610 | |
BDP1_HUMAN | BDP1 | physical | 26496610 | |
NKRF_HUMAN | NKRF | physical | 26496610 | |
ARV1_HUMAN | ARV1 | physical | 26496610 | |
RT15_HUMAN | MRPS15 | physical | 26496610 | |
FXRD2_HUMAN | FOXRED2 | physical | 26496610 | |
PCGF5_HUMAN | PCGF5 | physical | 26496610 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...