UniProt ID | RT12_HUMAN | |
---|---|---|
UniProt AC | O15235 | |
Protein Name | 28S ribosomal protein S12, mitochondrial | |
Gene Name | MRPS12 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 138 | |
Subcellular Localization | Mitochondrion . | |
Protein Description | ||
Protein Sequence | MSWSGLLHGLNTSLTCGPALVPRLWATCSMATLNQMHRLGPPKRPPRKLGPTEGRPQLKGVVLCTFTRKPKKPNSANRKCCRVRLSTGREAVCFIPGEGHTLQEHQIVLVEGGRTQDLPGVKLTVVRGKYDCGHVQKK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
29 | Phosphorylation | PRLWATCSMATLNQM HHHHHHHHHHHHHHH | 13.70 | - | |
32 | Phosphorylation | WATCSMATLNQMHRL HHHHHHHHHHHHHHH | 20.01 | - | |
52 | Phosphorylation | PPRKLGPTEGRPQLK CCCCCCCCCCCCCCC | 49.64 | 21406692 | |
122 | Ubiquitination | TQDLPGVKLTVVRGK CCCCCCCEEEEEECC | 44.34 | 21890473 | |
129 | 2-Hydroxyisobutyrylation | KLTVVRGKYDCGHVQ EEEEEECCCCCCCCC | 27.61 | - | |
129 | Acetylation | KLTVVRGKYDCGHVQ EEEEEECCCCCCCCC | 27.61 | 25825284 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RT12_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RT12_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RT12_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ERG28_HUMAN | C14orf1 | physical | 16169070 | |
DPYL1_HUMAN | CRMP1 | physical | 16169070 | |
U119A_HUMAN | UNC119 | physical | 16169070 | |
LRIF1_HUMAN | LRIF1 | physical | 16169070 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...