MIC10_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MIC10_HUMAN
• UniProt AC: Q5TGZ0
• Protein Name: MICOS complex subunit MIC10
• Gene Name: MINOS1
• Organism: Homo sapiens (Human).
• Sequence Length: 78
• Subcellular Localization: Mitochondrion inner membrane ; Single-pass membrane protein . The C-terminus is located in the intermembrane space (By similarity), while the location of the N-terminus has not been determined yet. As some programs predict the presence of 2 closely a
• Protein Description: Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane..
• Protein Sequence: MSESELGRKWDRCLADAVVKIGTGFGLGIVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKEQEQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MSESELGRK ------CCHHHHHHH		25944712
2	Phosphorylation	------MSESELGRK ------CCHHHHHHH		25159151
4	Phosphorylation	----MSESELGRKWD ----CCHHHHHHHHH		25159151

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MIC10_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MIC10_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MIC10_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MIC60_HUMAN	IMMT	physical	22114354
MIC19_HUMAN	CHCHD3	physical	22114354
GRP75_HUMAN	HSPA9	physical	22114354
MTX2_HUMAN	MTX2	physical	22114354
RMD1_HUMAN	RMDN1	physical	22114354
SAM50_HUMAN	SAMM50	physical	22114354
CAF17_HUMAN	IBA57	physical	22114354
ACOT9_HUMAN	ACOT9	physical	22114354
GDIA_HUMAN	GDI1	physical	22114354
DJC11_HUMAN	DNAJC11	physical	22114354
MK01_HUMAN	MAPK1	physical	22114354
GCP2_HUMAN	TUBGCP2	physical	22114354
MTX1_HUMAN	MTX1	physical	22114354
MTDC_HUMAN	MTHFD2	physical	22114354
HEMH_HUMAN	FECH	physical	22114354
TBG1_HUMAN	TUBG1	physical	22114354
COA7_HUMAN	COA7	physical	22114354
ACSL4_HUMAN	ACSL4	physical	22114354
C1QBP_HUMAN	C1QBP	physical	22114354
GSTK1_HUMAN	GSTK1	physical	22114354
TGO1_HUMAN	MIA3	physical	22114354
RDH13_HUMAN	RDH13	physical	22114354

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.