UniProt ID | LPAR4_HUMAN | |
---|---|---|
UniProt AC | Q99677 | |
Protein Name | Lysophosphatidic acid receptor 4 | |
Gene Name | LPAR4 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 370 | |
Subcellular Localization |
Cell membrane Multi-pass membrane protein. |
|
Protein Description | Receptor for lysophosphatidic acid (LPA), a mediator of diverse cellular activities. Transduces a signal by increasing the intracellular calcium ions and by stimulating adenylyl cyclase activity. The rank order of potency for agonists of this receptor is 1-oleoyl- > 1-stearoyl- > 1-palmitoyl- > 1-myristoyl- > 1-alkyl- > 1-alkenyl-LPA.. | |
Protein Sequence | MGDRRFIDFQFQDSNSSLRPRLGNATANNTCIVDDSFKYNLNGAVYSVVFILGLITNSVSLFVFCFRMKMRSETAIFITNLAVSDLLFVCTLPFKIFYNFNRHWPFGDTLCKISGTAFLTNIYGSMLFLTCISVDRFLAIVYPFRSRTIRTRRNSAIVCAGVWILVLSGGISASLFSTTNVNNATTTCFEGFSKRVWKTYLSKITIFIEVVGFIIPLILNVSCSSVVLRTLRKPATLSQIGTNKKKVLKMITVHMAVFVVCFVPYNSVLFLYALVRSQAITNCFLERFAKIMYPITLCLATLNCCFDPFIYYFTLESFQKSFYINAHIRMESLFKTETPLTTKPSLPAIQEEVSDQTTNNGGELMLESTF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
15 | N-linked_Glycosylation | DFQFQDSNSSLRPRL EEEEECCCCCCCCCC | 43.86 | UniProtKB CARBOHYD | |
24 | N-linked_Glycosylation | SLRPRLGNATANNTC CCCCCCCCCCCCCCE | 38.42 | UniProtKB CARBOHYD | |
28 | N-linked_Glycosylation | RLGNATANNTCIVDD CCCCCCCCCCEEECC | 39.73 | UniProtKB CARBOHYD | |
91 | Phosphorylation | SDLLFVCTLPFKIFY HHHHHHHCCCEEEEE | 31.97 | 28060719 | |
183 | N-linked_Glycosylation | FSTTNVNNATTTCFE HCCCCCCCCCCCCCC | 34.09 | 16335952 | |
236 | Phosphorylation | RTLRKPATLSQIGTN HHHCCCCCHHHCCCC | 35.15 | 29083192 | |
238 | Phosphorylation | LRKPATLSQIGTNKK HCCCCCHHHCCCCHH | 18.52 | 29083192 | |
242 | Phosphorylation | ATLSQIGTNKKKVLK CCHHHCCCCHHHHHH | 45.56 | 25278378 | |
332 | Phosphorylation | NAHIRMESLFKTETP EEEEEHHHHCCCCCC | 29.75 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LPAR4_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LPAR4_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LPAR4_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
N-linked Glycosylation | |
Reference | PubMed |
"Human plasma N-glycoproteome analysis by immunoaffinity subtraction,hydrazide chemistry, and mass spectrometry."; Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E.,Moore R.J., Smith R.D.; J. Proteome Res. 4:2070-2080(2005). Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-183, AND MASSSPECTROMETRY. |