| UniProt ID | LIN7C_MOUSE | |
|---|---|---|
| UniProt AC | O88952 | |
| Protein Name | Protein lin-7 homolog C | |
| Gene Name | Lin7c | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 197 | |
| Subcellular Localization |
Cell membrane Peripheral membrane protein. Basolateral cell membrane Peripheral membrane protein. Cell junction. Cell junction, synapse, postsynaptic cell membrane, postsynaptic density Peripheral membrane protein. Cell junction, tight junction. Cell j |
|
| Protein Description | Plays a role in establishing and maintaining the asymmetric distribution of channels and receptors at the plasma membrane of polarized cells. Forms membrane-associated multiprotein complexes that may regulate delivery and recycling of proteins to the correct membrane domains. The tripartite complex composed of LIN7 (LIN7A, LIN7B or LIN7C), CASK and APBA1 may have the potential to couple synaptic vesicle exocytosis to cell adhesion in brain. Ensures the proper localization of GRIN2B (subunit 2B of the NMDA receptor) to neuronal postsynaptic density and may function in localizing synaptic vesicles at synapses where it is recruited by beta-catenin and cadherin. Required to localize Kir2 channels, GABA transporter (SLC6A12) and EGFR/ERBB1, ERBB2, ERBB3 and ERBB4 to the basolateral membrane of epithelial cells.. | |
| Protein Sequence | MAALGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAVREVYEHVYETVDISSSPEVRANATAKATVAAFAASEGHSHPRVVELPKTEEGLGFNIMGGKEQNSPIYISRIIPGGIADRHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAQGKVKLVVRYTPKVLEEMESRFEKMRSAKRRQQT | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MAALGEPVR ------CCCCCCCCC | 16.05 | - | |
| 23 | Ubiquitination | RAIELLEKLQRSGEV HHHHHHHHHHHCCCC | 50.30 | - | |
| 76 | Ubiquitination | VRANATAKATVAAFA HHCHHHHHHHHHHHH | 39.99 | - | |
| 111 | Ubiquitination | GFNIMGGKEQNSPIY CCEECCCCCCCCCEE | 50.85 | - | |
| 115 | Phosphorylation | MGGKEQNSPIYISRI CCCCCCCCCEEEEEE | 16.63 | 29472430 | |
| 118 | Phosphorylation | KEQNSPIYISRIIPG CCCCCCEEEEEECCC | 9.02 | 29472430 | |
| 120 | Phosphorylation | QNSPIYISRIIPGGI CCCCEEEEEECCCCC | 10.64 | 29472430 | |
| 176 | Ubiquitination | LVVRYTPKVLEEMES EEEEECHHHHHHHHH | 52.21 | 27667366 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LIN7C_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LIN7C_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LIN7C_MOUSE !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...