UniProt ID | CCD32_HUMAN | |
---|---|---|
UniProt AC | Q9BV29 | |
Protein Name | Coiled-coil domain-containing protein 32 | |
Gene Name | CCDC32 {ECO:0000312|HGNC:HGNC:28295} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 185 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MKMFESADSTATRSGQDLWAEICSCLPNPEQEDGANNAFSDSFVDSCPEGEGQREVADFAVQPAVKPWAPLQDSEVYLASLEKKLRRIKGLNQEVTSKDMLRTLAQAKKECWDRFLQEKLASEFFVDGLDSDESTLEHFKRWLQPDKVAVSTEEVQYLIPPESQVEKPVAEDEPAAGDKPAAAEQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
66 | Ubiquitination | FAVQPAVKPWAPLQD EEECCCCCCCCCCCC | - | ||
83 | Ubiquitination | VYLASLEKKLRRIKG HHHHHHHHHHHHHCC | - | ||
89 | Ubiquitination | EKKLRRIKGLNQEVT HHHHHHHCCCCCCCC | - | ||
98 | Ubiquitination | LNQEVTSKDMLRTLA CCCCCCCHHHHHHHH | - | ||
98 (in isoform 2) | Ubiquitination | - | - | ||
107 (in isoform 2) | Ubiquitination | - | - | ||
108 | Acetylation | LRTLAQAKKECWDRF HHHHHHHHHHHHHHH | 30587517 | ||
119 | Ubiquitination | WDRFLQEKLASEFFV HHHHHHHHHHHHHCC | - | ||
131 | Phosphorylation | FFVDGLDSDESTLEH HCCCCCCCCHHHHHH | 28450419 | ||
134 | Phosphorylation | DGLDSDESTLEHFKR CCCCCCHHHHHHHHH | 27732954 | ||
135 | Phosphorylation | GLDSDESTLEHFKRW CCCCCHHHHHHHHHH | 27732954 | ||
140 | Ubiquitination | ESTLEHFKRWLQPDK HHHHHHHHHHHCCCC | - | ||
149 (in isoform 2) | Ubiquitination | - | - | ||
151 | Phosphorylation | QPDKVAVSTEEVQYL CCCCEEECHHHCEEE | 28796482 | ||
152 | Phosphorylation | PDKVAVSTEEVQYLI CCCEEECHHHCEEEC | 28796482 | ||
157 | Phosphorylation | VSTEEVQYLIPPESQ ECHHHCEEECCCHHH | 28796482 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CCD32_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CCD32_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CCD32_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CCD32_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...