CD006_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CD006_HUMAN
• UniProt AC: Q99440
• Protein Name: Uncharacterized protein encoded by LINC01587 {ECO:0000305}
• Gene Name: LINC01587 {ECO:0000312|HGNC:HGNC:13716}
• Organism: Homo sapiens (Human).
• Sequence Length: 93
• Protein Sequence: MDTQKQIHKTHNSKNQFFTIFFFLSVEFGKEGTRKNFYLLLSIGHYGRKSRRADLGTADTADKTEPECFAASWTFDPNPSVTVSGAHSTAVHQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
42	Phosphorylation	KNFYLLLSIGHYGRK CEEEEEEEECCCCCC	26.88	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CD006_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CD006_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CD006_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
DGKH_HUMAN	DGKH	physical	28514442
SMPX_HUMAN	SMPX	physical	28514442
DIRA1_HUMAN	DIRAS1	physical	28514442
SPTCS_HUMAN	SPG11	physical	28514442
APAF_HUMAN	APAF1	physical	28514442
UBA6_HUMAN	UBA6	physical	28514442
SEP10_HUMAN	SEPT10	physical	28514442
RLGPB_HUMAN	RALGAPB	physical	28514442
CLH2_HUMAN	CLTCL1	physical	28514442
URFB1_HUMAN	UHRF1BP1	physical	28514442
CK5P2_HUMAN	CDK5RAP2	physical	28514442
SHPK_HUMAN	SHPK	physical	28514442
TF65_HUMAN	RELA	physical	28514442
VP13C_HUMAN	VPS13C	physical	28514442
ACTA_HUMAN	ACTA2	physical	28514442
FR1OP_HUMAN	FGFR1OP	physical	28514442
CUL4B_HUMAN	CUL4B	physical	28514442
METH_HUMAN	MTR	physical	28514442
KIF11_HUMAN	KIF11	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.