DIRA1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: DIRA1_HUMAN
• UniProt AC: O95057
• Protein Name: GTP-binding protein Di-Ras1
• Gene Name: DIRAS1
• Organism: Homo sapiens (Human).
• Sequence Length: 198
• Subcellular Localization: Cell membrane ; Lipid-anchor ; Cytoplasmic side .
• Protein Description: Displays low GTPase activity and exists predominantly in the GTP-bound form..
• Protein Sequence: MPEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCDKSVCTLQITDTTGSHQFPAMQRLSISKGHAFILVFSVTSKQSLEELGPIYKLIVQIKGSVEDIPVMLVGNKCDETQREVDTREAQAVAQEWKCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRSGKQKRTDRVKGKCTLM

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
22	Phosphorylation	AGGVGKSSLVLRFVK CCCCCCHHHHHHHHC	26.44	20860994
29	Ubiquitination	SLVLRFVKGTFRDTY HHHHHHHCCCCCCCC	49.90	21890473
35	Phosphorylation	VKGTFRDTYIPTIED HCCCCCCCCCCCHHH	21.06	22468782
39	Phosphorylation	FRDTYIPTIEDTYRQ CCCCCCCCHHHHHHH	27.69	22468782
49	Phosphorylation	DTYRQVISCDKSVCT HHHHHHHCCCCCEEE	19.87	22468782
53	Phosphorylation	QVISCDKSVCTLQIT HHHCCCCCEEEEEEE	14.79	-
56	Phosphorylation	SCDKSVCTLQITDTT CCCCCEEEEEEECCC	21.39	27732954
60	Phosphorylation	SVCTLQITDTTGSHQ CEEEEEEECCCCCCC	17.84	27732954
62	Phosphorylation	CTLQITDTTGSHQFP EEEEEECCCCCCCCC	25.14	27732954
63	Ubiquitination	TLQITDTTGSHQFPA EEEEECCCCCCCCCC	39.22	21890473
63	Phosphorylation	TLQITDTTGSHQFPA EEEEECCCCCCCCCC	39.22	27732954
65	Phosphorylation	QITDTTGSHQFPAMQ EEECCCCCCCCCCEE	16.42	27732954
75	Phosphorylation	FPAMQRLSISKGHAF CCCEEEEEECCCCEE	27.31	29496963
77	Phosphorylation	AMQRLSISKGHAFIL CEEEEEECCCCEEEE	29.25	26699800
143	Ubiquitination	QAVAQEWKCAFMETS HHHHHHHHHHHHHHH	18.22	32015554
180	Ubiquitination	MSLNIDGKRSGKQKR CCCCCCCCCCCCCCC	39.38	32015554
195	Methylation	TDRVKGKCTLM---- CCCCCCEEEEC----	4.88	-
195	Geranylgeranylation	TDRVKGKCTLM---- CCCCCCEEEEC----	4.88	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of DIRA1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of DIRA1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of DIRA1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
A4_HUMAN	APP	physical	21832049

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.