| UniProt ID | TIPIN_MOUSE | |
|---|---|---|
| UniProt AC | Q91WA1 | |
| Protein Name | TIMELESS-interacting protein | |
| Gene Name | Tipin | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 278 | |
| Subcellular Localization | Cytoplasm . Nucleus . | |
| Protein Description | Plays an important role in the control of DNA replication and the maintenance of replication fork stability. Important for cell survival after DNA damage or replication stress. May be specifically required for the ATR-CHEK1 pathway in the replication checkpoint induced by hydroxyurea or ultraviolet light. Forms a complex with TIMELESS and this complex regulates DNA replication processes under both normal and stress conditions, stabilizes replication forks and influences both CHEK1 phosphorylation and the intra-S phase checkpoint in response to genotoxic stress.. | |
| Protein Sequence | MLEQEENGLFEIPDYEHVEDETFPPFPPPASPERDPADAEPEEGSGSGVPVPPKRTVKRNLPKLDATRLTSERGLPALRHVFDKTKFKGKGHEAEDLKTLIRHMEHWAHRLFPKLQFEDFIDRVENLGNKKEVQTCLKRIRLDLPIVHEDFVNNNDEVGEANGPDVSATGFDPFLTSSSDSRKFASEPTRSLTEEQQQRIERNKQLALERRQAKLLSNSQSLENDVTVEENSTGEDQEESNGLNIDTADGPHDVPFASTHEEEQCKAEETQLDHTNLD | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 31 | Phosphorylation | PPFPPPASPERDPAD CCCCCCCCCCCCCCC | 32.82 | 25338131 | |
| 191 | Phosphorylation | FASEPTRSLTEEQQQ HCCCCCCCCCHHHHH | 41.96 | 22067460 | |
| 219 | Phosphorylation | QAKLLSNSQSLENDV HHHHHHCCHHHHCCC | 20.12 | - | |
| 233 | Phosphorylation | VTVEENSTGEDQEES CEEECCCCCCCCHHH | 57.06 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TIPIN_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TIPIN_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TIPIN_MOUSE !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
