UniProt ID | PSF3_HUMAN | |
---|---|---|
UniProt AC | Q9BRX5 | |
Protein Name | DNA replication complex GINS protein PSF3 | |
Gene Name | GINS3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 216 | |
Subcellular Localization | Nucleus. | |
Protein Description | The GINS complex plays an essential role in the initiation of DNA replication, and progression of DNA replication forks. GINS complex seems to bind preferentially to single-stranded DNA.. | |
Protein Sequence | MSEAYFRVESGALGPEENFLSLDDILMSHEKLPVRTETAMPRLGAFFLERSAGAETDNAVPQGSKLELPLWLAKGLFDNKRRILSVELPKIYQEGWRTVFSADPNVVDLHKMGPHFYGFGSQLLHFDSPENADISQSLLQTFIGRFRRIMDSSQNAYNEDTSALVARLDEMERGLFQTGQKGLNDFQCWEKGQASQITASNLVQNYKKRKFTDMED | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
31 | Ubiquitination | DILMSHEKLPVRTET HHHHCCCCCCCCCCC | 53.30 | - | |
63 (in isoform 2) | Phosphorylation | - | 22.22 | 27174698 | |
65 | Ubiquitination | NAVPQGSKLELPLWL CCCCCCCCCCHHHHH | 53.45 | - | |
74 | Ubiquitination | ELPLWLAKGLFDNKR CHHHHHHHCCCCCCC | 54.71 | - | |
74 (in isoform 2) | Phosphorylation | - | 54.71 | 27174698 | |
75 (in isoform 2) | Phosphorylation | - | 26.43 | 27174698 | |
79 (in isoform 2) | Phosphorylation | - | 32.19 | 27174698 | |
80 | Ubiquitination | AKGLFDNKRRILSVE HHCCCCCCCEEEEEE | 44.92 | - | |
80 | Acetylation | AKGLFDNKRRILSVE HHCCCCCCCEEEEEE | 44.92 | 25953088 | |
80 | 2-Hydroxyisobutyrylation | AKGLFDNKRRILSVE HHCCCCCCCEEEEEE | 44.92 | - | |
83 (in isoform 2) | Phosphorylation | - | 3.79 | 27174698 | |
84 (in isoform 2) | Phosphorylation | - | 4.44 | 27174698 | |
90 (in isoform 1) | Ubiquitination | - | 67.67 | 21890473 | |
90 | Ubiquitination | ILSVELPKIYQEGWR EEEEECCHHHHCCHH | 67.67 | 21890473 | |
90 | Acetylation | ILSVELPKIYQEGWR EEEEECCHHHHCCHH | 67.67 | 23954790 | |
117 | Phosphorylation | HKMGPHFYGFGSQLL HHCCCCCCCCCCCCC | 14.44 | 26074081 | |
121 | Phosphorylation | PHFYGFGSQLLHFDS CCCCCCCCCCCCCCC | 18.52 | 26074081 | |
128 | Phosphorylation | SQLLHFDSPENADIS CCCCCCCCCCCCCCC | 32.92 | 26074081 | |
181 | Ubiquitination | GLFQTGQKGLNDFQC HHHHCCCCCCCCCCH | 67.71 | - | |
191 | Ubiquitination | NDFQCWEKGQASQIT CCCCHHHCCCCHHCC | 31.64 | - | |
195 | Phosphorylation | CWEKGQASQITASNL HHHCCCCHHCCHHHH | 17.77 | 25159151 | |
207 | Ubiquitination | SNLVQNYKKRKFTDM HHHHHHHHHCCCCCC | 54.36 | - | |
207 | Acetylation | SNLVQNYKKRKFTDM HHHHHHHHHCCCCCC | 54.36 | 24469663 | |
212 | Phosphorylation | NYKKRKFTDMED--- HHHHCCCCCCCC--- | 37.15 | 24719451 | |
251 (in isoform 3) | Phosphorylation | - | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PSF3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PSF3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PSF3_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SLD5_HUMAN | GINS4 | physical | 22939629 | |
PSF2_HUMAN | GINS2 | physical | 26186194 | |
MCM7_HUMAN | MCM7 | physical | 26186194 | |
TIM_HUMAN | TIMELESS | physical | 26186194 | |
PSF1_HUMAN | GINS1 | physical | 26186194 | |
MCM2_HUMAN | MCM2 | physical | 26186194 | |
SLD5_HUMAN | GINS4 | physical | 26186194 | |
CLSPN_HUMAN | CLSPN | physical | 26186194 | |
TIPIN_HUMAN | TIPIN | physical | 26186194 | |
PSF1_HUMAN | GINS1 | physical | 26344197 | |
PSF2_HUMAN | GINS2 | physical | 26344197 | |
SLD5_HUMAN | GINS4 | physical | 26344197 | |
PSF2_HUMAN | GINS2 | physical | 28514442 | |
SLD5_HUMAN | GINS4 | physical | 28514442 | |
PSF1_HUMAN | GINS1 | physical | 28514442 | |
CLSPN_HUMAN | CLSPN | physical | 28514442 | |
TIM_HUMAN | TIMELESS | physical | 28514442 | |
TIPIN_HUMAN | TIPIN | physical | 28514442 | |
MCM7_HUMAN | MCM7 | physical | 28514442 | |
SSRP1_HUMAN | SSRP1 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...