dbPTM

TDGF1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	TDGF1_HUMAN
UniProt AC	P13385
Protein Name	Teratocarcinoma-derived growth factor 1
Gene Name	TDGF1
Organism	Homo sapiens (Human).
Sequence Length	188
Subcellular Localization	Cell membrane Lipid-anchor, GPI-anchor . Secreted . Released from the cell membrane by GPI cleavage.
Protein Description	GPI-anchored cell membrane protein involved in Nodal signaling. Cell-associated TDGF1 acts as a Nodal coreceptor in cis. Shedding of TDGF1 by TMEM8A modulates Nodal signaling by allowing soluble TDGF1 to act as a Nodal coreceptor on other cells. [PubMed: 27881714 Could play a role in the determination of the epiblastic cells that subsequently give rise to the mesoderm]
Protein Sequence	MDCRKMARFSYSVIWIMAISKVFELGLVAGLGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPELPPSARTTTFMLVGICLSIQSYY

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
79	N-linked_Glycosylation	IQHSKELNRTCCLNG CCCCHHHCCCEECCC	38.00	UniProtKB CARBOHYD
117	Phosphorylation	VRKENCGSVPHDTWL HHHHCCCCCCCCCCC	34.37	21955146
122	Phosphorylation	CGSVPHDTWLPKKCS CCCCCCCCCCCCCCC	26.35	21955146
150	GPI-anchor	QAFLPGCDGLVMDEH CCCCCCCCEEEECHH	60.42	18930707

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of TDGF1_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of TDGF1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of TDGF1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
BAG6_HUMAN	BAG6	physical	16169070
ANGI_HUMAN	ANG	physical	16169070
CSN6_HUMAN	COPS6	physical	16169070
GDF9_HUMAN	GDF9	physical	16169070
LRIF1_HUMAN	LRIF1	physical	16169070
ACV1B_HUMAN	ACVR1B	physical	11909953
WDR26_HUMAN	WDR26	physical	26186194
AIP_HUMAN	AIP	physical	26186194
MYCB2_HUMAN	MYCBP2	physical	26186194
ARMC8_HUMAN	ARMC8	physical	26186194
MKLN1_HUMAN	MKLN1	physical	26186194
MAEA_HUMAN	MAEA	physical	26186194
RANB9_HUMAN	RANBP9	physical	26186194
RBP10_HUMAN	RANBP10	physical	26186194
RMD5A_HUMAN	RMND5A	physical	26186194
GID4_HUMAN	GID4	physical	26186194
GID8_HUMAN	GID8	physical	26186194
TCAL9_HUMAN	WBP5	physical	26186194
ZMY19_HUMAN	ZMYND19	physical	26186194
YPEL5_HUMAN	YPEL5	physical	26186194
RMD5B_HUMAN	RMND5B	physical	28514442
IL18_HUMAN	IL18	physical	28514442
GID4_HUMAN	GID4	physical	28514442
ZMY19_HUMAN	ZMYND19	physical	28514442
ARMC8_HUMAN	ARMC8	physical	28514442
GID8_HUMAN	GID8	physical	28514442
RMD5A_HUMAN	RMND5A	physical	28514442
MKLN1_HUMAN	MKLN1	physical	28514442
AIP_HUMAN	AIP	physical	28514442
WDR26_HUMAN	WDR26	physical	28514442
GLT18_HUMAN	GALNT18	physical	28514442
GDF11_HUMAN	GDF11	physical	28514442
SIL1_HUMAN	SIL1	physical	28514442
RBP10_HUMAN	RANBP10	physical	28514442
LRFN3_HUMAN	LRFN3	physical	28514442
MYCB2_HUMAN	MYCBP2	physical	28514442
MAEA_HUMAN	MAEA	physical	28514442
GALNS_HUMAN	GALNS	physical	28514442

Drug and Disease Associations

Kegg Disease
There are no disease associations of PTM sites.
OMIM Disease
There are no disease associations of PTM sites.
Kegg Drug
There are no disease associations of PTM sites.
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of TDGF1_HUMAN

Related Literatures of Post-Translational Modification

GPI-anchor
Reference	PubMed
"Characterization of the glycosylphosphatidylinositol-anchor signalsequence of human Cryptic with a hydrophilic extension."; Watanabe K., Nagaoka T., Strizzi L., Mancino M., Gonzales M.,Bianco C., Salomon D.S.; Biochim. Biophys. Acta 1778:2671-2681(2008). Cited for: SUBCELLULAR LOCATION, GPI-ANCHOR, AND MUTAGENESIS OF TYR-188.	18930707 [Abstract]