UniProt ID | TCAL9_HUMAN | |
---|---|---|
UniProt AC | Q9UHQ7 | |
Protein Name | Transcription elongation factor A protein-like 9 {ECO:0000312|HGNC:HGNC:30084} | |
Gene Name | TCEAL9 {ECO:0000312|HGNC:HGNC:30084} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 104 | |
Subcellular Localization | Nucleus . | |
Protein Description | May be involved in transcriptional regulation.. | |
Protein Sequence | MKSCQKMEGKPENESEPKHEEEPKPEEKPEEEEKLEEEAKAKGTFRERLIQSLQEFKEDIHNRHLSNEDMFREVDEIDEIRRVRNKLIVMRWKVNRNHPYPYLM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Phosphorylation | -----MKSCQKMEGK -----CCCHHCCCCC | 24719451 | ||
6 | Ubiquitination | --MKSCQKMEGKPEN --CCCHHCCCCCCCC | 21963094 | ||
10 | Ubiquitination | SCQKMEGKPENESEP CHHCCCCCCCCCCCC | 21963094 | ||
24 | Ubiquitination | PKHEEEPKPEEKPEE CCCCCCCCCCCCHHH | 21963094 | ||
28 | Ubiquitination | EEPKPEEKPEEEEKL CCCCCCCCHHHHHHH | 21963094 | ||
34 | Ubiquitination | EKPEEEEKLEEEAKA CCHHHHHHHHHHHHH | 21906983 | ||
40 | Ubiquitination | EKLEEEAKAKGTFRE HHHHHHHHHHCHHHH | 21906983 | ||
42 | Ubiquitination | LEEEAKAKGTFRERL HHHHHHHHCHHHHHH | 22817900 | ||
52 | Phosphorylation | FRERLIQSLQEFKED HHHHHHHHHHHHHHH | 24719451 | ||
57 | Ubiquitination | IQSLQEFKEDIHNRH HHHHHHHHHHHHHCC | 23000965 | ||
86 | Ubiquitination | EIRRVRNKLIVMRWK HHHHHHCCHHEEEEE | 32142685 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TCAL9_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TCAL9_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TCAL9_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
UBP11_HUMAN | USP11 | physical | 17353931 | |
SDCG3_HUMAN | SDCCAG3 | physical | 17353931 | |
ERD21_HUMAN | KDELR1 | physical | 17353931 | |
RL31_HUMAN | RPL31 | physical | 17353931 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...