ERD21_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ERD21_HUMAN
• UniProt AC: P24390
• Protein Name: ER lumen protein-retaining receptor 1
• Gene Name: KDELR1
• Organism: Homo sapiens (Human).
• Sequence Length: 212
• Subcellular Localization: Cytoplasmic vesicle, COPI-coated vesicle membrane ; Multi-pass membrane protein . Endoplasmic reticulum membrane ; Multi-pass membrane protein . Endoplasmic reticulum-Golgi intermediate compartment membrane .
• Protein Description: Required for the retention of luminal endoplasmic reticulum resident proteins via vesicular recycling. This receptor recognizes the C-terminal K-D-E-L motif. COPI-coated transport intermediates, either in the form of round vesicles or as tubular processes, mediate retrograde traffic of the KDEL receptor-ligand complexes. Also required for normal vesicular traffic through the Golgi..
• Protein Sequence: MNLFRFLGDLSHLLAIILLLLKIWKSRSCAGISGKSQVLFAVVFTARYLDLFTNYISLYNTCMKVVYIACSFTTVWLIYSKFKATYDGNHDTFRVEFLVVPTAILAFLVNHDFTPLEILWTFSIYLESVAILPQLFMVSKTGEAETITSHYLFALGVYRTLYLFNWIWRYHFEGFFDLIAIVAGLVQTVLYCDFFYLYITKVLKGKKLSLPA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
61	Phosphorylation	NYISLYNTCMKVVYI HHHHHHHHHHHHHHH	10.62	-
64	Ubiquitination	SLYNTCMKVVYIACS HHHHHHHHHHHHHHC	30.60	33845483
81	Ubiquitination	TVWLIYSKFKATYDG HHHHHHHHHHEEECC	33.63	22817900
83	Ubiquitination	WLIYSKFKATYDGNH HHHHHHHHEEECCCC	43.48	22817900
83	Ubiquitination	WLIYSKFKATYDGNH HHHHHHHHEEECCCC	43.48	21890473
141	Phosphorylation	QLFMVSKTGEAETIT HHHCCCCCCCCEEHH	32.52	25954137
146	Phosphorylation	SKTGEAETITSHYLF CCCCCCEEHHHHHHH	36.28	25954137
148	Phosphorylation	TGEAETITSHYLFAL CCCCEEHHHHHHHHH	19.51	21406692
149	Phosphorylation	GEAETITSHYLFALG CCCEEHHHHHHHHHH	13.29	21406692
151	Phosphorylation	AETITSHYLFALGVY CEEHHHHHHHHHHHH	11.86	25954137
158	Phosphorylation	YLFALGVYRTLYLFN HHHHHHHHHHHHHHH	8.97	21406692
191	Phosphorylation	GLVQTVLYCDFFYLY HHHHHHHHHCHHHHH	5.90	22817900
196	Phosphorylation	VLYCDFFYLYITKVL HHHHCHHHHHHHHHH	9.89	22817900
198	Phosphorylation	YCDFFYLYITKVLKG HHCHHHHHHHHHHCC	8.65	22817900
209	Phosphorylation	VLKGKKLSLPA---- HHCCCCCCCCC----	40.98	28355574

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
209	S	Phosphorylation	Kinase	PRKACA	P17612	GPS
209	S	Phosphorylation	Kinase	PKA	-	Uniprot

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
209	S	Phosphorylation	Phosphorylation by PKA at Ser-209 is required for endoplasmic reticulum retention function.	14517323

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ERD21_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ARFG1_HUMAN	ARFGAP1	physical	9405360
ERD21_HUMAN	KDELR1	physical	9405360
UBE3A_HUMAN	UBE3A	physical	28514442
UBL7_HUMAN	UBL7	physical	28514442
MINY1_HUMAN	FAM63A	physical	28514442
VPS36_HUMAN	VPS36	physical	28514442
TAXB1_HUMAN	TAX1BP1	physical	28514442
TRAD1_HUMAN	TRAFD1	physical	28514442
UCHL5_HUMAN	UCHL5	physical	28514442
PSD11_HUMAN	PSMD11	physical	28514442
UBQL4_HUMAN	UBQLN4	physical	28514442
NPL4_HUMAN	NPLOC4	physical	28514442
PSD12_HUMAN	PSMD12	physical	28514442
PSMD6_HUMAN	PSMD6	physical	28514442
UBQL1_HUMAN	UBQLN1	physical	28514442
RN115_HUMAN	RNF115	physical	28514442
PSMD4_HUMAN	PSMD4	physical	28514442

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.