UniProt ID | ANGI_HUMAN | |
---|---|---|
UniProt AC | P03950 | |
Protein Name | Angiogenin | |
Gene Name | ANG | |
Organism | Homo sapiens (Human). | |
Sequence Length | 147 | |
Subcellular Localization | Cytoplasmic vesicle, secretory vesicle lumen . Secreted . Nucleus . Nucleus, nucleolus . Rapidly endocytosed by target cells and translocated to the nucleus where it accumulates in the nucleolus and binds to DNA (PubMed:12051708). | |
Protein Description | Binds to actin on the surface of endothelial cells; once bound, angiogenin is endocytosed and translocated to the nucleus. Stimulates ribosomal RNA synthesis including that containing the initiation site sequences of 45S rRNA. Cleaves tRNA within anticodon loops to produce tRNA-derived stress-induced fragments (tiRNAs) which inhibit protein synthesis and triggers the assembly of stress granules (SGs). Angiogenin induces vascularization of normal and malignant tissues. Angiogenic activity is regulated by interaction with RNH1 in vivo.. | |
Protein Sequence | MVMGLGVLLLVFVLGLGLTPPTLAQDNSRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLTSPCKDINTFIHGNKRSIKAICENKNGNPHRENLRISKSSFQVTTCKLHGGSPWPPCQYRATAGFRNVVVACENGLPVHLDQSIFRRP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
25 | Pyrrolidone_carboxylic_acid | LTPPTLAQDNSRYTH CCCCCHHCCCHHHHH | 54.23 | - | |
25 | Pyrrolidone_carboxylic_acid | LTPPTLAQDNSRYTH CCCCCHHCCCHHHHH | 54.23 | 2866794 | |
25 | Pyrrolidone_carboxylic_acid | LTPPTLAQDNSRYTH CCCCCHHCCCHHHHH | 54.23 | 2866794 | |
38 | Phosphorylation | THFLTQHYDAKPQGR HHHHHCCCCCCCCCC | 14.05 | 20560525 | |
96 | Phosphorylation | HRENLRISKSSFQVT CHHCCEECCCEEEEE | 21.76 | 30850123 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ANGI_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ANGI_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ANGI_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
P53_HUMAN | TP53 | physical | 22266868 | |
RINI_HUMAN | RNH1 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
611895 | Amyotrophic lateral sclerosis 9 (ALS9) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...