ANGI_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ANGI_HUMAN
• UniProt AC: P03950
• Protein Name: Angiogenin
• Gene Name: ANG
• Organism: Homo sapiens (Human).
• Sequence Length: 147
• Subcellular Localization: Cytoplasmic vesicle, secretory vesicle lumen . Secreted . Nucleus . Nucleus, nucleolus . Rapidly endocytosed by target cells and translocated to the nucleus where it accumulates in the nucleolus and binds to DNA (PubMed:12051708).
• Protein Description: Binds to actin on the surface of endothelial cells; once bound, angiogenin is endocytosed and translocated to the nucleus. Stimulates ribosomal RNA synthesis including that containing the initiation site sequences of 45S rRNA. Cleaves tRNA within anticodon loops to produce tRNA-derived stress-induced fragments (tiRNAs) which inhibit protein synthesis and triggers the assembly of stress granules (SGs). Angiogenin induces vascularization of normal and malignant tissues. Angiogenic activity is regulated by interaction with RNH1 in vivo..
• Protein Sequence: MVMGLGVLLLVFVLGLGLTPPTLAQDNSRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLTSPCKDINTFIHGNKRSIKAICENKNGNPHRENLRISKSSFQVTTCKLHGGSPWPPCQYRATAGFRNVVVACENGLPVHLDQSIFRRP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
25	Pyrrolidone_carboxylic_acid	LTPPTLAQDNSRYTH CCCCCHHCCCHHHHH	54.23	-
25	Pyrrolidone_carboxylic_acid	LTPPTLAQDNSRYTH CCCCCHHCCCHHHHH	54.23	2866794
25	Pyrrolidone_carboxylic_acid	LTPPTLAQDNSRYTH CCCCCHHCCCHHHHH	54.23	2866794
38	Phosphorylation	THFLTQHYDAKPQGR HHHHHCCCCCCCCCC	14.05	20560525
96	Phosphorylation	HRENLRISKSSFQVT CHHCCEECCCEEEEE	21.76	30850123

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ANGI_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ANGI_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ANGI_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
P53_HUMAN	TP53	physical	22266868
RINI_HUMAN	RNH1	physical	28514442

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• 611895: Amyotrophic lateral sclerosis 9 (ALS9)
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Pyrrolidone carboxylic acid

"Amino acid sequence of human tumor derived angiogenin.";
Strydom D.J., Fett J.W., Lobb R.R., Alderman E.M., Bethune J.L.,Riordan J.F., Vallee B.L.;
Biochemistry 24:5486-5494(1985).
Cited for: PROTEIN SEQUENCE OF 25-147, AND DISULFIDE BONDS.
PubMed: 2866794