TCL1B_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TCL1B_HUMAN
• UniProt AC: O95988
• Protein Name: T-cell leukemia/lymphoma protein 1B
• Gene Name: TCL1B
• Organism: Homo sapiens (Human).
• Sequence Length: 128
• Protein Description: Enhances the phosphorylation and activation of AKT1 and AKT2..
• Protein Sequence: MASEASVRLGVPPGRLWIQRPGIYEDEEGRTWVTVVVRFNPSRREWARASQGSRYEPSITVHLWQMAVHTRELLSSGQMPFSQLPAVWQLYPGRKYRAADSSFWEIADHGQIDSMEQLVLTYQPERKD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
101	Phosphorylation	RKYRAADSSFWEIAD CCEEECCCCHHHCCC	23.78	22210691
102	Phosphorylation	KYRAADSSFWEIADH CEEECCCCHHHCCCC	34.62	22210691
127	Ubiquitination	LTYQPERKD------ HHCCCCCCC------	67.15	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TCL1B_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TCL1B_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TCL1B_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
A4_HUMAN	APP	physical	21832049
ACD11_HUMAN	ACAD11	physical	26186194
MED13_HUMAN	MED13	physical	26186194
HPS3_HUMAN	HPS3	physical	26186194
MED1_HUMAN	MED1	physical	26186194
BIG1_HUMAN	ARFGEF1	physical	26186194
STRN4_HUMAN	STRN4	physical	26186194
MED14_HUMAN	MED14	physical	26186194
MAGI3_HUMAN	MAGI3	physical	26186194
HPS6_HUMAN	HPS6	physical	26186194
HPS5_HUMAN	HPS5	physical	26186194
IMDH1_HUMAN	IMPDH1	physical	26186194
MED23_HUMAN	MED23	physical	26186194
MED4_HUMAN	MED4	physical	26186194
MED16_HUMAN	MED16	physical	26186194
CCDC6_HUMAN	CCDC6	physical	26186194
MED29_HUMAN	MED29	physical	26186194
MED22_HUMAN	MED22	physical	26186194
MED24_HUMAN	MED24	physical	26186194
MED10_HUMAN	MED10	physical	26186194
NDE1_HUMAN	NDE1	physical	26186194
SAR1B_HUMAN	SAR1B	physical	26186194
MED17_HUMAN	MED17	physical	26186194
MED28_HUMAN	MED28	physical	26186194
MED15_HUMAN	MED15	physical	26186194
MED20_HUMAN	MED20	physical	26186194
DISC1_HUMAN	DISC1	physical	26186194
MED8_HUMAN	MED8	physical	26186194
MAGI3_HUMAN	MAGI3	physical	28514442
HPS5_HUMAN	HPS5	physical	28514442
MED13_HUMAN	MED13	physical	28514442
BIG1_HUMAN	ARFGEF1	physical	28514442
MED22_HUMAN	MED22	physical	28514442
ACD11_HUMAN	ACAD11	physical	28514442
MED24_HUMAN	MED24	physical	28514442
MED10_HUMAN	MED10	physical	28514442
MED17_HUMAN	MED17	physical	28514442
MED8_HUMAN	MED8	physical	28514442
MED14_HUMAN	MED14	physical	28514442
MED1_HUMAN	MED1	physical	28514442
MED29_HUMAN	MED29	physical	28514442
MED4_HUMAN	MED4	physical	28514442
HPS3_HUMAN	HPS3	physical	28514442
MED20_HUMAN	MED20	physical	28514442
NDE1_HUMAN	NDE1	physical	28514442
MED28_HUMAN	MED28	physical	28514442
MED9_HUMAN	MED9	physical	28514442
SAR1B_HUMAN	SAR1B	physical	28514442
DISC1_HUMAN	DISC1	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.