UniProt ID | SYPH_HUMAN | |
---|---|---|
UniProt AC | P08247 | |
Protein Name | Synaptophysin | |
Gene Name | SYP | |
Organism | Homo sapiens (Human). | |
Sequence Length | 313 | |
Subcellular Localization |
Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane Multi-pass membrane protein . Cell junction, synapse, synaptosome . |
|
Protein Description | Possibly involved in structural functions as organizing other membrane components or in targeting the vesicles to the plasma membrane. Involved in the regulation of short-term and long-term synaptic plasticity (By similarity).. | |
Protein Sequence | MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYSGELQLSVDCANKTESDLSIEVEFEYPFRLHQVYFDAPTCRGGTTKVFLVGDYSSSAEFFVTVAVFAFLYSMGALATYIFLQNKYRENNKGPMLDFLATAVFAFMWLVSSSAWAKGLSDVKMATDPENIIKEMPVCRQTGNTCKELRDPVTSGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFLRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPAGSGGSGYGPQGDYGQQGYGPQGAPTSFSNQM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
59 | N-linked_Glycosylation | QLSVDCANKTESDLS EEEEEECCCCCCCCE | 59.10 | UniProtKB CARBOHYD | |
73 | Phosphorylation | SIEVEFEYPFRLHQV EEEEEEECCCEEEEE | 17.00 | - | |
81 | Phosphorylation | PFRLHQVYFDAPTCR CCEEEEEEEECCCCC | 6.81 | 24927040 | |
86 | Phosphorylation | QVYFDAPTCRGGTTK EEEEECCCCCCCCEE | 19.29 | 24076635 | |
168 | Ubiquitination | AKGLSDVKMATDPEN HCCCCCCEECCCHHH | 28.01 | - | |
186 | Phosphorylation | EMPVCRQTGNTCKEL HCCCCCCCCCCHHHH | 17.04 | 26033855 | |
250 | Phosphorylation | QPAPGDAYGDAGYGQ CCCCCCCCCCCCCCC | 21.93 | 25884760 | |
250 | Nitration | QPAPGDAYGDAGYGQ CCCCCCCCCCCCCCC | 21.93 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
- | K | Ubiquitination | E3 ubiquitin ligase | SIAH1 | Q8IUQ4 | PMID:15064394 |
- | K | Ubiquitination | E3 ubiquitin ligase | SIAH2 | O43255 | PMID:22199232 |
- | K | Ubiquitination | E3 ubiquitin ligase | PRKN | O60260 | PMID:16135753 |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SYPH_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SYPH_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
AP1G1_HUMAN | AP1G1 | physical | 12498786 | |
SRCN1_HUMAN | SRCIN1 | physical | 18662323 | |
T183A_HUMAN | TMEM183A | physical | 28514442 | |
PTPS_HUMAN | PTS | physical | 28514442 | |
SCMC3_HUMAN | SLC25A23 | physical | 28514442 | |
MRS2_HUMAN | MRS2 | physical | 28514442 | |
S35B2_HUMAN | SLC35B2 | physical | 28514442 | |
SFXN3_HUMAN | SFXN3 | physical | 28514442 | |
S20A2_HUMAN | SLC20A2 | physical | 28514442 | |
GDC_HUMAN | SLC25A16 | physical | 28514442 | |
TMTC4_HUMAN | TMTC4 | physical | 28514442 | |
SGPP1_HUMAN | SGPP1 | physical | 28514442 | |
ATP9A_HUMAN | ATP9A | physical | 28514442 | |
TM87A_HUMAN | TMEM87A | physical | 28514442 | |
EXT1_HUMAN | EXT1 | physical | 28514442 | |
TM186_HUMAN | TMEM186 | physical | 28514442 | |
ERD23_HUMAN | KDELR3 | physical | 28514442 | |
JIP4_HUMAN | SPAG9 | physical | 28514442 | |
TM164_HUMAN | TMEM164 | physical | 28514442 | |
APBB1_HUMAN | APBB1 | physical | 28514442 | |
S38AA_HUMAN | SLC38A10 | physical | 28514442 | |
MBOA7_HUMAN | MBOAT7 | physical | 28514442 | |
ARV1_HUMAN | ARV1 | physical | 28514442 | |
ARL5B_HUMAN | ARL5B | physical | 28514442 | |
GLPK_HUMAN | GK | physical | 28514442 | |
RN5A_HUMAN | RNASEL | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
H00053 | Extraskeletal myxoid chondrosarcoma | |||||
H00577 | Syndromic X-linked mental retardation with epilepsy or seizures, including: West syndrome (WS); Part | |||||
OMIM Disease | ||||||
300802 | Mental retardation, X-linked, SYP-related (MRXSYP) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...