UniProt ID | SCMC3_HUMAN | |
---|---|---|
UniProt AC | Q9BV35 | |
Protein Name | Calcium-binding mitochondrial carrier protein SCaMC-3 | |
Gene Name | SLC25A23 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 468 | |
Subcellular Localization |
Mitochondrion inner membrane Multi-pass membrane protein . |
|
Protein Description | Calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. [PubMed: 15123600 May act as a ATP-Mg/Pi exchanger that mediates the transport of Mg-ATP in exchange for phosphate, catalyzing the net uptake or efflux of adenine nucleotides into or from the mitochondria] | |
Protein Sequence | MRGSPGDAERRQRWGRLFEELDSNKDGRVDVHELRQGLARLGGGNPDPGAQQGISSEGDADPDGGLDLEEFSRYLQEREQRLLLMFHSLDRNQDGHIDVSEIQQSFRALGISISLEQAEKILHSMDRDGTMTIDWQEWRDHFLLHSLENVEDVLYFWKHSTVLDIGECLTVPDEFSKQEKLTGMWWKQLVAGAVAGAVSRTGTAPLDRLKVFMQVHASKTNRLNILGGLRSMVLEGGIRSLWRGNGINVLKIAPESAIKFMAYEQIKRAILGQQETLHVQERFVAGSLAGATAQTIIYPMEVLKTRLTLRRTGQYKGLLDCARRILEREGPRAFYRGYLPNVLGIIPYAGIDLAVYETLKNWWLQQYSHDSADPGILVLLACGTISSTCGQIASYPLALVRTRMQAQASIEGGPQLSMLGLLRHILSQEGMRGLYRGIAPNFMKVIPAVSISYVVYENMKQALGVTSR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | O-linked_Glycosylation | ----MRGSPGDAERR ----CCCCCCHHHHH | 18.49 | 30379171 | |
175 (in isoform 3) | Phosphorylation | - | 16.81 | 22617229 | |
181 (in isoform 3) | Phosphorylation | - | 5.01 | 22617229 | |
240 | Phosphorylation | VLEGGIRSLWRGNGI HHHCCHHHHHCCCCC | 30.29 | 24719451 | |
251 | Ubiquitination | GNGINVLKIAPESAI CCCCCEEEECCHHHH | 32.32 | 27667366 | |
251 (in isoform 4) | Ubiquitination | - | 32.32 | 21906983 | |
251 (in isoform 2) | Ubiquitination | - | 32.32 | 21906983 | |
251 (in isoform 1) | Ubiquitination | - | 32.32 | 21906983 | |
256 | Phosphorylation | VLKIAPESAIKFMAY EEEECCHHHHHHHHH | 33.95 | - | |
259 | Ubiquitination | IAPESAIKFMAYEQI ECCHHHHHHHHHHHH | 28.89 | - | |
263 | Phosphorylation | SAIKFMAYEQIKRAI HHHHHHHHHHHHHHH | 9.14 | - | |
267 (in isoform 4) | Ubiquitination | - | 35.16 | 21906983 | |
267 (in isoform 2) | Ubiquitination | - | 35.16 | 21906983 | |
267 (in isoform 1) | Ubiquitination | - | 35.16 | 21906983 | |
267 | Ubiquitination | FMAYEQIKRAILGQQ HHHHHHHHHHHHCCC | 35.16 | - | |
292 | Phosphorylation | AGSLAGATAQTIIYP HHCCCCHHHHEEEEC | 20.55 | - | |
298 | Ubiquitination | ATAQTIIYPMEVLKT HHHHEEEECHHHHHH | 7.83 | 27667366 | |
298 (in isoform 3) | Ubiquitination | - | 7.83 | 21906983 | |
308 | Phosphorylation | EVLKTRLTLRRTGQY HHHHHHHHHHHHCCC | 18.22 | 22210691 | |
314 (in isoform 3) | Ubiquitination | - | 35.83 | 21906983 | |
367 | Phosphorylation | KNWWLQQYSHDSADP HHHHHHHCCCCCCCC | 8.60 | - | |
368 | Phosphorylation | NWWLQQYSHDSADPG HHHHHHCCCCCCCCC | 19.24 | - | |
402 (in isoform 2) | Phosphorylation | - | 24.02 | 30622161 | |
409 | Phosphorylation | TRMQAQASIEGGPQL HHHHHHHHCCCCHHH | 14.75 | 23663014 | |
417 | Phosphorylation | IEGGPQLSMLGLLRH CCCCHHHHHHHHHHH | 13.50 | 23663014 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SCMC3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SCMC3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SCMC3_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SCMC3_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...