UniProt ID | T183A_HUMAN | |
---|---|---|
UniProt AC | Q8IXX5 | |
Protein Name | Transmembrane protein 183A | |
Gene Name | TMEM183A | |
Organism | Homo sapiens (Human). | |
Sequence Length | 376 | |
Subcellular Localization |
Membrane Single-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MARGPGPLGRPRPDTVAMPKRGKRLKFRAHDACSGRVTVADYANSDPAVVRSGRVKKAVANAVQQEVKSLCGLEASQVPAEEALSGAGEPCDIIDSSDEMDAQEESIHERTVSRKKKSKRHKEELDGAGGEEYPMDIWLLLASYIRPEDIVNFSLICKNAWTVTCTAAFWTRLYRRHYTLDASLPLRLRPESMEKLRCLRACVIRSLYHMYEPFAARISKNPAIPESTPSTLKNSKCLLFWCRKIVGNRQEPMWEFNFKFKKQSPRLKSKCTGGLQPPVQYEDVHTNPDQDCCLLQVTTLNFIFIPIVMGMIFTLFTINVSTDMRHHRVRLVFQDSPVHGGRKLRSEQGVQVILDPVHSVRLFDWWHPQYPFSLRA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
34 | Phosphorylation | FRAHDACSGRVTVAD EEEECCCCCCEEEHH | 31.21 | 28348404 | |
57 | Acetylation | VRSGRVKKAVANAVQ HHCCHHHHHHHHHHH | 45.28 | 7427851 | |
57 | Sumoylation | VRSGRVKKAVANAVQ HHCCHHHHHHHHHHH | 45.28 | - | |
57 | Sumoylation | VRSGRVKKAVANAVQ HHCCHHHHHHHHHHH | 45.28 | - | |
96 | Phosphorylation | EPCDIIDSSDEMDAQ CCCCCCCCCCCCHHH | 29.31 | 28348404 | |
97 | Phosphorylation | PCDIIDSSDEMDAQE CCCCCCCCCCCHHHH | 33.57 | 28348404 | |
183 | Phosphorylation | RHYTLDASLPLRLRP HHCCCCCCCCCCCCH | 30.13 | 24719451 | |
202 | Ubiquitination | KLRCLRACVIRSLYH HHHHHHHHHHHHHHH | 1.80 | 21963094 | |
203 | Ubiquitination | LRCLRACVIRSLYHM HHHHHHHHHHHHHHH | 3.88 | 21963094 | |
205 | Ubiquitination | CLRACVIRSLYHMYE HHHHHHHHHHHHHHH | 10.54 | 22817900 | |
206 | Ubiquitination | LRACVIRSLYHMYEP HHHHHHHHHHHHHHH | 23.35 | 22817900 | |
220 | Ubiquitination | PFAARISKNPAIPES HHHHHHCCCCCCCCC | 65.66 | - | |
232 | Ubiquitination | PESTPSTLKNSKCLL CCCCCCHHCCCEEEE | 6.08 | 21963094 | |
233 (in isoform 2) | Ubiquitination | - | 60.30 | 21906983 | |
233 (in isoform 1) | Ubiquitination | - | 60.30 | 21906983 | |
233 | Ubiquitination | ESTPSTLKNSKCLLF CCCCCHHCCCEEEEE | 60.30 | 27667366 | |
235 | Ubiquitination | TPSTLKNSKCLLFWC CCCHHCCCEEEEEHH | 24.14 | 22817900 | |
236 | Ubiquitination | PSTLKNSKCLLFWCR CCHHCCCEEEEEHHH | 37.99 | 22817900 | |
336 | Phosphorylation | VRLVFQDSPVHGGRK EEEEEECCCCCCCCC | 20.31 | 23186163 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of T183A_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of T183A_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of T183A_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...