| UniProt ID | PPP6_MOUSE | |
|---|---|---|
| UniProt AC | Q9CQR6 | |
| Protein Name | Serine/threonine-protein phosphatase 6 catalytic subunit | |
| Gene Name | Ppp6c | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 305 | |
| Subcellular Localization | Cytoplasm. | |
| Protein Description | A component of a signaling pathway regulating cell cycle progression in response to IL2 receptor stimulation. N-terminal domain restricts G1 to S phase progression in cancer cells, in part through control of cyclin D1. Downregulates MAP3K7 kinase activation of the IL1 signaling pathway by dephosphorylation of MAP3K7 (By similarity).. | |
| Protein Sequence | MAPLDLDKYVEIARQCKYLPENDLKRLCDYVCDLLLEESNVQPVSTPVTVCGDIHGQFYDLCELFRTGGQVPDTNYIFMGDFVDRGYYSLETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANAWRYCTKVFDMLTVAALIDEQILCVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSDPEDVDTWAISPRGAGWLFGAKVTNEFVHINNLKLICRAHQLVHEGYKFMFDEKLVTVWSAPNYCYRCGNIASIMVFKDVNTREPKLFRAVPDSERVIPPRTTTPYFL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MAPLDLDK -------CCCCCHHH | 8.60 | - | |
| 8 | Ubiquitination | MAPLDLDKYVEIARQ CCCCCHHHHHHHHHH | 59.50 | 22790023 | |
| 9 | Phosphorylation | APLDLDKYVEIARQC CCCCHHHHHHHHHHC | 11.72 | - | |
| 18 | Phosphorylation | EIARQCKYLPENDLK HHHHHCCCCCHHHHH | 34.81 | - | |
| 25 | Ubiquitination | YLPENDLKRLCDYVC CCCHHHHHHHHHHHH | 46.30 | 22790023 | |
| 197 | Phosphorylation | AFCDLVWSDPEDVDT CCCCEEECCHHHCCC | 35.49 | 26643407 | |
| 261 | Phosphorylation | TVWSAPNYCYRCGNI EEECCCCCCCCCCCE | 6.98 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PPP6_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PPP6_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PPP6_MOUSE !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
