| UniProt ID | PGAP2_HUMAN | |
|---|---|---|
| UniProt AC | Q9UHJ9 | |
| Protein Name | Post-GPI attachment to proteins factor 2 | |
| Gene Name | PGAP2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 254 | |
| Subcellular Localization |
Golgi apparatus membrane Multi-pass membrane protein. Endoplasmic reticulum membrane Multi-pass membrane protein. |
|
| Protein Description | Involved in the lipid remodeling steps of GPI-anchor maturation. Required for stable expression of GPI-anchored proteins at the cell surface (By similarity).. | |
| Protein Sequence | MYQVPLPLDRDGTLVRLRFTMVALVTVCCPLVAFLFCILWSLLFHFKETTATHCGVPNYLPSVSSAIGGEVPQRYVWRFCIGLHSAPRFLVAFAYWNHYLSCTSPCSCYRPLCRLNFGLNVVENLALLVLTYVSSSEDFTIHENAFIVFIASSLGHMLLTCILWRLTKKHTVSQEDRKSYSWKQRLFIINFISFFSALAVYFRHNMYCEAGVYTIFAILEYTVVLTNMAFHMTAWWDFGNKELLITSQPEEKRF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 (in isoform 2) | Phosphorylation | - | 20.44 | 27642862 | |
| 7 | Phosphorylation | -MYQVPLPLDRDGTL -CCCCCCCCCCCCCE | 26.58 | - | |
| 7 (in isoform 5) | Phosphorylation | - | 26.58 | - | |
| 16 | Phosphorylation | DRDGTLVRLRFTMVA CCCCCEEHHHHHHHH | 24.21 | - | |
| 16 (in isoform 5) | Phosphorylation | - | 24.21 | 24719451 | |
| 171 | Phosphorylation | WRLTKKHTVSQEDRK HHHHCCCCCCHHHHH | 23.26 | 22210691 | |
| 173 | Phosphorylation | LTKKHTVSQEDRKSY HHCCCCCCHHHHHCC | 1.64 | 22210691 | |
| 252 | Ubiquitination | ITSQPEEKRF----- EECCCCHHCC----- | 3.31 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PGAP2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PGAP2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PGAP2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| KR109_HUMAN | KRTAP10-9 | physical | 25416956 | |
| KR103_HUMAN | KRTAP10-3 | physical | 25416956 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
