| UniProt ID | PAU19_YEAST | |
|---|---|---|
| UniProt AC | P0CE85 | |
| Protein Name | Seripauperin-19 | |
| Gene Name | PAU19 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 124 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MVKLTSIAAGVAAIAAGVAAAPATTTLSPSDERVNLVELGVYVSDIRAHLAQYYLFQAAHPTETYPVEIAEAVFNYGDFTTMLTGIPAEQVTRVITGVPWYSTRLRPAISSALSKDGIYTAIPK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of PAU19_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PAU19_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PAU19_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PAU19_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CDC24_YEAST | CDC24 | genetic | 27708008 | |
| LCB2_YEAST | LCB2 | genetic | 27708008 | |
| SAM35_YEAST | SAM35 | genetic | 27708008 | |
| CDC15_YEAST | CDC15 | genetic | 27708008 | |
| CALM_YEAST | CMD1 | genetic | 27708008 | |
| ARP2_YEAST | ARP2 | genetic | 27708008 | |
| GPI8_YEAST | GPI8 | genetic | 27708008 | |
| MOB2_YEAST | MOB2 | genetic | 27708008 | |
| PSA1_YEAST | SCL1 | genetic | 27708008 | |
| SP105_YEAST | SPC105 | genetic | 27708008 | |
| ARP4_YEAST | ARP4 | genetic | 27708008 | |
| SWD2_YEAST | SWD2 | genetic | 27708008 | |
| CDC16_YEAST | CDC16 | genetic | 27708008 | |
| TAF4_YEAST | TAF4 | genetic | 27708008 | |
| DPOA_YEAST | POL1 | genetic | 27708008 | |
| TPT1_YEAST | TPT1 | genetic | 27708008 | |
| SYH_YEAST | HTS1 | genetic | 27708008 | |
| SLX5_YEAST | SLX5 | genetic | 27708008 | |
| STF2_YEAST | STF2 | genetic | 27708008 | |
| AIM17_YEAST | AIM17 | genetic | 27708008 | |
| VPS29_YEAST | VPS29 | genetic | 27708008 | |
| RS27B_YEAST | RPS27B | genetic | 27708008 | |
| STB5_YEAST | STB5 | genetic | 27708008 | |
| YH02_YEAST | YHR202W | genetic | 27708008 | |
| GIS4_YEAST | GIS4 | genetic | 27708008 | |
| ADE_YEAST | AAH1 | genetic | 27708008 | |
| VAM3_YEAST | VAM3 | genetic | 27708008 | |
| PMA2_YEAST | PMA2 | genetic | 27708008 | |
| UBA3_YEAST | UBA3 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...