UniProt ID | PAU19_YEAST | |
---|---|---|
UniProt AC | P0CE85 | |
Protein Name | Seripauperin-19 | |
Gene Name | PAU19 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 124 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MVKLTSIAAGVAAIAAGVAAAPATTTLSPSDERVNLVELGVYVSDIRAHLAQYYLFQAAHPTETYPVEIAEAVFNYGDFTTMLTGIPAEQVTRVITGVPWYSTRLRPAISSALSKDGIYTAIPK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of PAU19_YEAST !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PAU19_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PAU19_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PAU19_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CDC24_YEAST | CDC24 | genetic | 27708008 | |
LCB2_YEAST | LCB2 | genetic | 27708008 | |
SAM35_YEAST | SAM35 | genetic | 27708008 | |
CDC15_YEAST | CDC15 | genetic | 27708008 | |
CALM_YEAST | CMD1 | genetic | 27708008 | |
ARP2_YEAST | ARP2 | genetic | 27708008 | |
GPI8_YEAST | GPI8 | genetic | 27708008 | |
MOB2_YEAST | MOB2 | genetic | 27708008 | |
PSA1_YEAST | SCL1 | genetic | 27708008 | |
SP105_YEAST | SPC105 | genetic | 27708008 | |
ARP4_YEAST | ARP4 | genetic | 27708008 | |
SWD2_YEAST | SWD2 | genetic | 27708008 | |
CDC16_YEAST | CDC16 | genetic | 27708008 | |
TAF4_YEAST | TAF4 | genetic | 27708008 | |
DPOA_YEAST | POL1 | genetic | 27708008 | |
TPT1_YEAST | TPT1 | genetic | 27708008 | |
SYH_YEAST | HTS1 | genetic | 27708008 | |
SLX5_YEAST | SLX5 | genetic | 27708008 | |
STF2_YEAST | STF2 | genetic | 27708008 | |
AIM17_YEAST | AIM17 | genetic | 27708008 | |
VPS29_YEAST | VPS29 | genetic | 27708008 | |
RS27B_YEAST | RPS27B | genetic | 27708008 | |
STB5_YEAST | STB5 | genetic | 27708008 | |
YH02_YEAST | YHR202W | genetic | 27708008 | |
GIS4_YEAST | GIS4 | genetic | 27708008 | |
ADE_YEAST | AAH1 | genetic | 27708008 | |
VAM3_YEAST | VAM3 | genetic | 27708008 | |
PMA2_YEAST | PMA2 | genetic | 27708008 | |
UBA3_YEAST | UBA3 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...