| UniProt ID | NR1I2_HUMAN | |
|---|---|---|
| UniProt AC | O75469 | |
| Protein Name | Nuclear receptor subfamily 1 group I member 2 | |
| Gene Name | NR1I2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 434 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Nuclear receptor that binds and is activated by variety of endogenous and xenobiotic compounds. Transcription factor that activates the transcription of multiple genes involved in the metabolism and secretion of potentially harmful xenobiotics, drugs and endogenous compounds. Activated by the antibiotic rifampicin and various plant metabolites, such as hyperforin, guggulipid, colupulone, and isoflavones. Response to specific ligands is species-specific. Activated by naturally occurring steroids, such as pregnenolone and progesterone. Binds to a response element in the promoters of the CYP3A4 and ABCB1/MDR1 genes.. | |
| Protein Sequence | MEVRPKESWNHADFVHCEDTESVPGKPSVNADEEVGGPQICRVCGDKATGYHFNVMTCEGCKGFFRRAMKRNARLRCPFRKGACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSSGCELPESLQAPSREEAAKWSQVRKDLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLLPHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAAFELCQLRFNTVFNAETGTWECGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQHRVVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGITGS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 8 | Phosphorylation | MEVRPKESWNHADFV CCCCCCCCCCCCCEE | 39.03 | 19617467 | |
| 57 | Phosphorylation | GYHFNVMTCEGCKGF CCEEEEEECCCCHHH | 11.79 | 19171678 | |
| 101 | Ubiquitination | CQACRLRKCLESGMK HHHHHHHHHHHHCCC | 48.00 | - | |
| 109 | Acetylation | CLESGMKKEMIMSDE HHHHCCCHHHHCCHH | 43.55 | 108936999 | |
| 114 | Phosphorylation | MKKEMIMSDEAVEER CCHHHHCCHHHHHHH | 22.75 | - | |
| 133 | Phosphorylation | KRKKSERTGTQPLGV HHHHHCCCCCCCCCC | 40.30 | 27251275 | |
| 135 | Phosphorylation | KKSERTGTQPLGVQG HHHCCCCCCCCCCCC | 26.80 | - | |
| 167 | Phosphorylation | KTFDTTFSHFKNFRL HHCCCCHHHHCCCCC | 26.39 | - | |
| 172 | Phosphorylation | TFSHFKNFRLPGVLS CHHHHCCCCCCCCCC | 9.76 | 27251275 | |
| 200 | Phosphorylation | REEAAKWSQVRKDLC HHHHHHHHHHHHHHH | 20.35 | - | |
| 208 | Phosphorylation | QVRKDLCSLKVSLQL HHHHHHHCCEEEEEE | 38.22 | 23684312 | |
| 212 | Phosphorylation | DLCSLKVSLQLRGED HHHCCEEEEEECCCC | 14.60 | 23684312 | |
| 221 | Phosphorylation | QLRGEDGSVWNYKPP EECCCCCCCEECCCC | 35.96 | - | |
| 247 | Phosphorylation | LPHMADMSTYMFKGI HHHHCCCHHHHHHHH | 19.55 | 26074081 | |
| 248 | Phosphorylation | PHMADMSTYMFKGII HHHCCCHHHHHHHHH | 16.62 | 26074081 | |
| 249 | Phosphorylation | HMADMSTYMFKGIIS HHCCCHHHHHHHHHH | 8.01 | 26074081 | |
| 256 | Phosphorylation | YMFKGIISFAKVISY HHHHHHHHHHHHHHH | 19.75 | 26074081 | |
| 274 | Phosphorylation | LPIEDQISLLKGAAF CCHHHHHHHHHHHHH | 23.24 | 24719451 | |
| 290 | Phosphorylation | LCQLRFNTVFNAETG HHCHHHCCEEECCCC | 24.62 | - | |
| 305 | Phosphorylation | TWECGRLSYCLEDTA EEEECCEEEEEECCC | 16.67 | 19617467 | |
| 350 | Phosphorylation | MQAISLFSPDRPGVL HHHHHHHCCCCCCCC | 31.05 | 18784074 | |
| 408 | Phosphorylation | RSINAQHTQRLLRIQ HHCCHHHHHHHHHHH | 11.87 | 19617467 | |
| 422 | Phosphorylation | QDIHPFATPLMQELF HHCCCCCHHHHHHHH | 19.82 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
| 114 | S | Phosphorylation | Kinase | CDK2 | P24941 | PSP |
| 133 | T | Phosphorylation | Kinase | CDK2 | P24941 | PSP |
| 135 | T | Phosphorylation | Kinase | CDK2 | P24941 | PSP |
| 167 | S | Phosphorylation | Kinase | CDK2 | P24941 | PSP |
| 200 | S | Phosphorylation | Kinase | CDK2 | P24941 | PSP |
| 290 | T | Phosphorylation | Kinase | CAMK2A | Q9UQM7 | PSP |
| 350 | S | Phosphorylation | Kinase | CDK2 | P24941 | PSP |
| 350 | S | Phosphorylation | Kinase | VRK1 | Q99986 | PSP |
| 408 | T | Phosphorylation | Kinase | PRKCA | P17252 | GPS |
| - | K | Ubiquitination | E3 ubiquitin ligase | UBR5 | O95071 | PMID:24438055 |
| - | K | Ubiquitination | E3 ubiquitin ligase | RBCK1 | Q9BYM8 | PMID:23160820 |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NR1I2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NR1I2_HUMAN !! | ||||||
| Kegg Disease | |
|---|---|
| There are no disease associations of PTM sites. | |
| OMIM Disease | |
| There are no disease associations of PTM sites. | |
| Kegg Drug | |
| There are no disease associations of PTM sites. | |
| DrugBank | |
| DB01248 | Docetaxel |
| DB00530 | Erlotinib |
| DB00783 | Estradiol |
| DB00977 | Ethinyl Estradiol |
| DB01229 | Paclitaxel |
| DB01045 | Rifampicin |
| DB01220 | Rifaximin |
| DB08864 | Rilpivirine |
| DB00163 | Vitamin E |
loading...
