UniProt ID | NP1L5_HUMAN | |
---|---|---|
UniProt AC | Q96NT1 | |
Protein Name | Nucleosome assembly protein 1-like 5 | |
Gene Name | NAP1L5 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 182 | |
Subcellular Localization | Nucleus . | |
Protein Description | ||
Protein Sequence | MADSENQGPAEPSQAAAAAEAAAEEVMAEGGAQGGDCDSAAGDPDSAAGQMAEEPQTPAENAPKPKNDFIESLPNSVKCRVLALKKLQKRCDKIEAKFDKEFQALEKKYNDIYKPLLAKIQELTGEMEGCAWTLEGEEEEEEEYEDDEEEGEDEEEEEAAAEAAAGAKHDDAHAEMPDDAKK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
66 | Ubiquitination | AENAPKPKNDFIESL CCCCCCCCCCHHHHC | 75.24 | 29967540 | |
72 | Phosphorylation | PKNDFIESLPNSVKC CCCCHHHHCCCHHHH | 44.29 | 22617229 | |
76 | Phosphorylation | FIESLPNSVKCRVLA HHHHCCCHHHHHHHH | 22.48 | 29214152 | |
78 | Ubiquitination | ESLPNSVKCRVLALK HHCCCHHHHHHHHHH | 19.02 | 23000965 | |
85 | Ubiquitination | KCRVLALKKLQKRCD HHHHHHHHHHHHHHH | 45.92 | - | |
97 | Ubiquitination | RCDKIEAKFDKEFQA HHHHHHHHHHHHHHH | 41.11 | 32142685 | |
100 | Ubiquitination | KIEAKFDKEFQALEK HHHHHHHHHHHHHHH | 64.66 | 32142685 | |
107 | Ubiquitination | KEFQALEKKYNDIYK HHHHHHHHHHHHHHH | 62.50 | 32142685 | |
108 | Ubiquitination | EFQALEKKYNDIYKP HHHHHHHHHHHHHHH | 39.65 | 30230243 | |
114 | Ubiquitination | KKYNDIYKPLLAKIQ HHHHHHHHHHHHHHH | 29.53 | 32142685 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NP1L5_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NP1L5_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NP1L5_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...