| UniProt ID | NEU2_HUMAN | |
|---|---|---|
| UniProt AC | P01185 | |
| Protein Name | Vasopressin-neurophysin 2-copeptin | |
| Gene Name | AVP | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 164 | |
| Subcellular Localization | Secreted. | |
| Protein Description | Neurophysin 2 specifically binds vasopressin.; Vasopressin has a direct antidiuretic action on the kidney, it also causes vasoconstriction of the peripheral vessels. Acts by binding to vasopressin receptors (V1bR/AVPR1B, V1aR/AVPR1A, and V2R/AVPR2). [PubMed: 18174156] | |
| Protein Sequence | MPDTMLPACFLGLLAFSSACYFQNCPRGGKRAMSDLELRQCLPCGPGGKGRCFGPSICCADELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAAFGVCCNDESCVTEPECREGFHRRARASDRSNATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 28 | Glycine amide | YFQNCPRGGKRAMSD HHHCCCCCCCCCCCC | 30.99 | - | |
| 28 | Amidation | YFQNCPRGGKRAMSD HHHCCCCCCCCCCCC | 30.99 | 13591312 | |
| 34 | Phosphorylation | RGGKRAMSDLELRQC CCCCCCCCCCCHHHC | 37.75 | 29691806 | |
| 131 | N-linked_Glycosylation | ARASDRSNATQLDGP HHHCCCCCCCCCCCH | 48.15 | UniProtKB CARBOHYD |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NEU2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NEU2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NEU2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CRYAB_HUMAN | CRYAB | physical | 17075130 | |
| NEU2_HUMAN | AVP | physical | 17075130 | |
| CRYAB_HUMAN | CRYAB | physical | 16274233 | |
| DLX2_HUMAN | DLX2 | physical | 24722188 | |
| VHL_HUMAN | VHL | physical | 28514442 | |
| NIF3L_HUMAN | NIF3L1 | physical | 28514442 | |
| HTRA1_HUMAN | HTRA1 | physical | 28514442 | |
| CDN2C_HUMAN | CDKN2C | physical | 28514442 | |
| FNTB_HUMAN | FNTB | physical | 28514442 | |
| ATE1_HUMAN | ATE1 | physical | 28514442 | |
| ARSB_HUMAN | ARSB | physical | 28514442 | |
| BDH2_HUMAN | BDH2 | physical | 28514442 | |
| GLT18_HUMAN | GALNT18 | physical | 28514442 | |
| B4GT6_HUMAN | B4GALT6 | physical | 28514442 | |
| B4GT5_HUMAN | B4GALT5 | physical | 28514442 | |
| CUL2_HUMAN | CUL2 | physical | 28514442 | |
| NDUF5_HUMAN | NDUFAF5 | physical | 28514442 | |
| CHST3_HUMAN | CHST3 | physical | 28514442 | |
| MICA_HUMAN | MICA | physical | 28514442 | |
| SIA4C_HUMAN | ST3GAL4 | physical | 28514442 | |
| ANAG_HUMAN | NAGLU | physical | 28514442 | |
| GEMI6_HUMAN | GEMIN6 | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| 125700 | Diabetes insipidus, neurohypophyseal (NDI) | |||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
