| UniProt ID | SIA4C_HUMAN | |
|---|---|---|
| UniProt AC | Q11206 | |
| Protein Name | CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 | |
| Gene Name | ST3GAL4 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 333 | |
| Subcellular Localization |
Golgi apparatus, Golgi stack membrane Single-pass type II membrane protein. Secreted. Membrane-bound form in trans cisternae of Golgi. Secreted into the body fluid. |
|
| Protein Description | Catalyzes the formation of the NeuAc-alpha-2,3-Gal-beta-1,4-GlcNAc-, and NeuAc-alpha-2,3-Gal-beta-1,3-GlcNAc- sequences found in terminal carbohydrate groups of glycoproteins and glycolipids. It may be involved in the biosynthesis of the sialyl Lewis X determinant.. | |
| Protein Sequence | MVSKSRWKLLAMLALVLVVMVWYSISREDRYIELFYFPIPEKKEPCLQGEAESKASKLFGNYSRDQPIFLRLEDYFWVKTPSAYELPYGTKGSEDLLLRVLAITSSSIPKNIQSLRCRRCVVVGNGHRLRNSSLGDAINKYDVVIRLNNAPVAGYEGDVGSKTTMRLFYPESAHFDPKVENNPDTLLVLVAFKAMDFHWIETILSDKKRVRKGFWKQPPLIWDVNPKQIRILNPFFMEIAADKLLSLPMQQPRKIKQKPTTGLLAITLALHLCDLVHIAGFGYPDAYNKKQTIHYYEQITLKSMAGSGHNVSQEALAIKRMLEMGAIKNLTSF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 61 | N-linked_Glycosylation | KASKLFGNYSRDQPI HHHHHHCCCCCCCCE | 25.03 | UniProtKB CARBOHYD | |
| 91 | Ubiquitination | YELPYGTKGSEDLLL CCCCCCCCCCHHHHH | 56.95 | - | |
| 93 | Phosphorylation | LPYGTKGSEDLLLRV CCCCCCCCHHHHHHH | 29.50 | 22985185 | |
| 97 (in isoform 4) | Ubiquitination | - | 4.43 | - | |
| 104 | Phosphorylation | LLRVLAITSSSIPKN HHHHHHHHCCCCCCC | 19.56 | - | |
| 131 | N-linked_Glycosylation | GNGHRLRNSSLGDAI CCCCCCCCCCHHHHH | 40.31 | UniProtKB CARBOHYD | |
| 140 | Ubiquitination | SLGDAINKYDVVIRL CHHHHHHHCCEEEEE | 36.39 | - | |
| 146 (in isoform 4) | Ubiquitination | - | 21.54 | - | |
| 151 (in isoform 3) | Ubiquitination | - | 20.72 | 21906983 | |
| 158 (in isoform 5) | Ubiquitination | - | 29.66 | 21906983 | |
| 161 (in isoform 2) | Ubiquitination | - | 27.03 | 21906983 | |
| 162 | Ubiquitination | YEGDVGSKTTMRLFY CCCCCCCCEEEEEEC | 41.93 | 2190698 | |
| 162 (in isoform 1) | Ubiquitination | - | 41.93 | 21906983 | |
| 168 (in isoform 4) | Ubiquitination | - | 7.25 | 21906983 | |
| 202 | Phosphorylation | MDFHWIETILSDKKR HCHHHHHHHHCCCHH | 20.34 | - | |
| 307 | Phosphorylation | TLKSMAGSGHNVSQE EHHHHCCCCCCCCHH | 27.60 | - | |
| 310 | N-linked_Glycosylation | SMAGSGHNVSQEALA HHCCCCCCCCHHHHH | 38.37 | UniProtKB CARBOHYD | |
| 312 | Phosphorylation | AGSGHNVSQEALAIK CCCCCCCCHHHHHHH | 27.85 | - | |
| 328 | Trimethylation | MLEMGAIKNLTSF-- HHHHCCCCCCCCC-- | 45.42 | - | |
| 328 | Methylation | MLEMGAIKNLTSF-- HHHHCCCCCCCCC-- | 45.42 | - | |
| 329 | N-linked_Glycosylation | LEMGAIKNLTSF--- HHHCCCCCCCCC--- | 42.30 | UniProtKB CARBOHYD |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SIA4C_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SIA4C_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SIA4C_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| FAM3C_HUMAN | FAM3C | physical | 26186194 | |
| IMPA3_HUMAN | IMPAD1 | physical | 26186194 | |
| MANEL_HUMAN | MANEAL | physical | 26186194 | |
| TBC15_HUMAN | TBC1D15 | physical | 26186194 | |
| C1GLC_HUMAN | C1GALT1C1 | physical | 26186194 | |
| CGAT2_HUMAN | CSGALNACT2 | physical | 26186194 | |
| RMND1_HUMAN | RMND1 | physical | 26186194 | |
| DYR2_HUMAN | DHFRL1 | physical | 26186194 | |
| F213A_HUMAN | FAM213A | physical | 26186194 | |
| OAF_HUMAN | OAF | physical | 26186194 | |
| PCSK1_HUMAN | PCSK1N | physical | 26186194 | |
| BT2A2_HUMAN | BTN2A2 | physical | 26186194 | |
| LRFN3_HUMAN | LRFN3 | physical | 26186194 | |
| FAM3C_HUMAN | FAM3C | physical | 28514442 | |
| DYR2_HUMAN | DHFRL1 | physical | 28514442 | |
| CGAT2_HUMAN | CSGALNACT2 | physical | 28514442 | |
| LRFN3_HUMAN | LRFN3 | physical | 28514442 | |
| MANEL_HUMAN | MANEAL | physical | 28514442 | |
| OAF_HUMAN | OAF | physical | 28514442 | |
| TBC15_HUMAN | TBC1D15 | physical | 28514442 | |
| C1GLC_HUMAN | C1GALT1C1 | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
