dbPTM

C1GLC_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	C1GLC_HUMAN
UniProt AC	Q96EU7
Protein Name	C1GALT1-specific chaperone 1
Gene Name	C1GALT1C1
Organism	Homo sapiens (Human).
Sequence Length	318
Subcellular Localization	Membrane Single-pass type II membrane protein .
Protein Description	Probable chaperone required for the generation of 1 O-glycan Gal-beta1-3GalNAc-alpha1-Ser/Thr (T antigen), which is a precursor for many extended O-glycans in glycoproteins. Probably acts as a specific molecular chaperone assisting the folding/stability of core 1 beta-3-galactosyltransferase (C1GALT1)..
Protein Sequence	MLSESSSFLKGVMLGSIFCALITMLGHIRIGHGNRMHHHEHHHLQAPNKEDILKISEDERMELSKSFRVYCIILVKPKDVSLWAAVKETWTKHCDKAEFFSSENVKVFESINMDTNDMWLMMRKAYKYAFDKYRDQYNWFFLARPTTFAIIENLKYFLLKKDPSQPFYLGHTIKSGDLEYVGMEGGIVLSVESMKRLNSLLNIPEKCPEQGGMIWKISEDKQLAVCLKYAGVFAENAEDADGKDVFNTKSVGLSIKEAMTYHPNQVVEGCCSDMAVTFNGLTPNQMHVMMYGVYRLRAFGHIFNDALVFLPPNGSDND

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
7	Phosphorylation	-MLSESSSFLKGVML -CCCCHHHHHHHHHH	43.83	24719451
54	Ubiquitination	PNKEDILKISEDERM CCHHHHHCCCHHHHH	44.51	29967540
81	Phosphorylation	LVKPKDVSLWAAVKE EECCCCHHHHHHHHH	28.47	25159151
92	Ubiquitination	AVKETWTKHCDKAEF HHHHHHHHHCCHHHH	33.52	29967540
96	Ubiquitination	TWTKHCDKAEFFSSE HHHHHCCHHHHCCCC	56.03	29967540
126	Phosphorylation	WLMMRKAYKYAFDKY HHHHHHHHHHHHHHH	13.94	28555341
127	Ubiquitination	LMMRKAYKYAFDKYR HHHHHHHHHHHHHHH	34.66	29967540
161	Ubiquitination	LKYFLLKKDPSQPFY HHEECCCCCCCCCCC	74.88	29967540
175	Phosphorylation	YLGHTIKSGDLEYVG CCCCEECCCCEEEEE	33.42	24043423
180	Phosphorylation	IKSGDLEYVGMEGGI ECCCCEEEEEEECEE	15.03	24043423
190	Phosphorylation	MEGGIVLSVESMKRL EECEEEEEHHHHHHH	16.97	24043423
193	Phosphorylation	GIVLSVESMKRLNSL EEEEEHHHHHHHHHH	27.70	24043423
206	Ubiquitination	SLLNIPEKCPEQGGM HHHCCCHHCCCCCCE	50.13	21963094
216	Ubiquitination	EQGGMIWKISEDKQL CCCCEEEEECCCHHH	25.98	29967540
221	Ubiquitination	IWKISEDKQLAVCLK EEEECCCHHHHHHHH	43.06	29967540
243	Ubiquitination	NAEDADGKDVFNTKS CCCCCCCCCCCCCCC	51.79	21963094
249	Ubiquitination	GKDVFNTKSVGLSIK CCCCCCCCCCCEEHH	44.22	33845483

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of C1GLC_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of C1GLC_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of C1GLC_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
LEG3_HUMAN	LGALS3	physical	18695044

Drug and Disease Associations

Kegg Disease
H01188	Tn syndrome
OMIM Disease
300622	Tn polyagglutination syndrome (TNPS)
Kegg Drug
There are no disease associations of PTM sites.
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of C1GLC_HUMAN

Related Literatures of Post-Translational Modification