OAF_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: OAF_HUMAN
• UniProt AC: Q86UD1
• Protein Name: Out at first protein homolog
• Gene Name: OAF
• Organism: Homo sapiens (Human).
• Sequence Length: 273
• Protein Sequence: MRLPGVPLARPALLLLLPLLAPLLGTGAPAELRVRVRLPDGQVTEESLQADSDADSISLELRKPDGTLVSFTADFKKDVKVFRALILGELEKGQSQFQALCFVTQLQHNEIIPSEAMAKLRQKNPRAVRQAEEVRGLEHLHMDVAVNFSQGALLSPHLHNVCAEAVDAIYTRQEDVRFWLEQGVDSSVFEALPKASEQAELPRCRQVGDHGKPCVCRYGLSLAWYPCMLKYCHSRDRPTPYKCGIRSCQKSYSFDFYVPQRQLCLWDEDPYPG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
58	Phosphorylation	DSDADSISLELRKPD CCCCCEEEEEEECCC	21.53	24719451
196	Phosphorylation	FEALPKASEQAELPR HHHCCCHHHHCCCCC	36.05	22210691
217	Methylation	HGKPCVCRYGLSLAW CCCCCCHHHCCHHHH	14.25	115387419

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of OAF_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of OAF_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of OAF_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of OAF_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.