| UniProt ID | NANO2_HUMAN | |
|---|---|---|
| UniProt AC | P60321 | |
| Protein Name | Nanos homolog 2 | |
| Gene Name | NANOS2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 138 | |
| Subcellular Localization | Cytoplasm . Cytoplasm, P-body. Cytoplasm, perinuclear region . Localizes at P-bodies during gonocyte development (By similarity). More abundant in perinuclear region of the cytoplasm of the germ cells of the adult testis.. | |
| Protein Description | Plays a key role in the sexual differentiation of germ cells by promoting the male fate but suppressing the female fate. Represses the female fate pathways by suppressing meiosis, which in turn results in the promotion of the male fate. Maintains the suppression of meiosis by preventing STRA8 expression, which is required for premeiotic DNA replication, after CYP26B1 is decreased. Regulates the localization of the CCR4-NOT deadenylation complex to P-bodies and plays a role in recruiting the complex to trigger the degradation of mRNAs involved in meiosis. Required for the maintenance of the spermatogonial stem cell population. Not essential for the assembly of P-bodies but is required for the maintenance of their normal state (By similarity).. | |
| Protein Sequence | MQLPPFDMWKDYFNLSQVVWALIASRGQRLETQEIEEPSPGPPLGQDQGLGAPGANGGLGTLCNFCKHNGESRHVYSSHQLKTPDGVVVCPILRHYVCPVCGATGDQAHTLKYCPLNGGQQSLYRRSGRNSAGRRVKR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of NANO2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NANO2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NANO2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CNOT1_HUMAN | CNOT1 | physical | 24736845 | |
| CNOT3_HUMAN | CNOT3 | physical | 24736845 | |
| CNOT6_HUMAN | CNOT6 | physical | 28514442 | |
| CNO6L_HUMAN | CNOT6L | physical | 28514442 | |
| CNOT2_HUMAN | CNOT2 | physical | 28514442 | |
| TOB2_HUMAN | TOB2 | physical | 28514442 | |
| TB182_HUMAN | TNKS1BP1 | physical | 28514442 | |
| BTG3_HUMAN | BTG3 | physical | 28514442 | |
| CNO11_HUMAN | CNOT11 | physical | 28514442 | |
| CNO10_HUMAN | CNOT10 | physical | 28514442 | |
| CNOT3_HUMAN | CNOT3 | physical | 28514442 | |
| MINK1_HUMAN | MINK1 | physical | 28514442 | |
| CNOT1_HUMAN | CNOT1 | physical | 28514442 | |
| CNOT9_HUMAN | RQCD1 | physical | 28514442 | |
| CNOT8_HUMAN | CNOT8 | physical | 28514442 | |
| GPBL1_HUMAN | GPBP1L1 | physical | 28514442 | |
| CNOT7_HUMAN | CNOT7 | physical | 28514442 | |
| FHL2_HUMAN | FHL2 | physical | 28514442 | |
| IL36A_HUMAN | IL36A | physical | 28514442 | |
| M4K4_HUMAN | MAP4K4 | physical | 28514442 | |
| TNKS2_HUMAN | TNKS2 | physical | 28514442 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
