UniProt ID | MTM1_YEAST | |
---|---|---|
UniProt AC | P53320 | |
Protein Name | Mitochondrial carrier protein MTM1 | |
Gene Name | MTM1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 366 | |
Subcellular Localization |
Mitochondrion inner membrane Multi-pass membrane protein . |
|
Protein Description | Involved in the mitochondrial activation of SOD2 by specifically facilitating insertion of the essential manganese cofactor. Has the ability to activate iron regulon in an iron-dependent manner. Responds to calorie restriction (CR) strength.. | |
Protein Sequence | MSDRNTSNSLTLKERMLSAGAGSVLTSLILTPMDVVRIRLQQQQMIPDCSCDGAAEVPNAVSSGSKMKTFTNVGGQNLNNAKIFWESACFQELHCKNSSLKFNGTLEAFTKIASVEGITSLWRGISLTLLMAIPANMVYFSGYEYIRDVSPIASTYPTLNPLFCGAIARVFAATSIAPLELVKTKLQSIPRSSKSTKTWMMVKDLLNETRQEMKMVGPSRALFKGLEITLWRDVPFSAIYWSSYELCKERLWLDSTRFASKDANWVHFINSFASGCISGMIAAICTHPFDVGKTRWQISMMNNSDPKGGNRSRNMFKFLETIWRTEGLAALYTGLAARVIKIRPSCAIMISSYEISKKVFGNKLHQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of MTM1_YEAST !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MTM1_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MTM1_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MTM1_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
DHOM_YEAST | HOM6 | physical | 22940862 | |
SSB1_YEAST | SSB1 | physical | 22940862 | |
LCB2_YEAST | LCB2 | genetic | 27708008 | |
NEP1_YEAST | EMG1 | genetic | 27708008 | |
MAK5_YEAST | MAK5 | genetic | 27708008 | |
RPAB1_YEAST | RPB5 | genetic | 27708008 | |
RRP1_YEAST | RRP1 | genetic | 27708008 | |
RMRP_YEAST | SNM1 | genetic | 27708008 | |
RSP5_YEAST | RSP5 | genetic | 27708008 | |
COPB2_YEAST | SEC27 | genetic | 27708008 | |
CP51_YEAST | ERG11 | genetic | 27708008 | |
NSE1_YEAST | NSE1 | genetic | 27708008 | |
NMT_YEAST | NMT1 | genetic | 27708008 | |
SEC22_YEAST | SEC22 | genetic | 27708008 | |
ERG8_YEAST | ERG8 | genetic | 27708008 | |
RRP5_YEAST | RRP5 | genetic | 27708008 | |
RNT1_YEAST | RNT1 | genetic | 27708008 | |
GPN2_YEAST | GPN2 | genetic | 27708008 | |
TF2B_YEAST | SUA7 | genetic | 27708008 | |
FMC1_YEAST | FMC1 | genetic | 27708008 | |
GSH1_YEAST | GSH1 | genetic | 27708008 | |
GSHB_YEAST | GSH2 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...