| UniProt ID | MPPD1_HUMAN | |
|---|---|---|
| UniProt AC | O15442 | |
| Protein Name | Metallophosphoesterase domain-containing protein 1 | |
| Gene Name | MPPED1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 326 | |
| Subcellular Localization | ||
| Protein Description | May have metallophosphoesterase activity (in vitro).. | |
| Protein Sequence | MWRSRWDASVLKAEALALLPCGLGMAFSQSHVMAARRHQHSRLIIEVDEYSSNPTQAFTFYNINQGRFQPPHVQMVDPVPHDAPKPPGYTRFVCVSDTHSRTDPIQMPYGDVLIHAGDFTELGLPSEVKKFNEWLGSLPYEYKIVIAGNHELTFDQEFMADLIKQDFYYFPSVSKLKPENYENVQSLLTNCIYLQDSEVTVRGFRIYGSPWQPWFYGWGFNLPRGQALLEKWNLIPEGVDILITHGPPLGFLDWVPKKMQRVGCVELLNTVQRRVQPRLHVFGHIHEGYGVMADGTTTYVNASVCTVNYQPVNPPIVIDLPTPRNS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 102 | Phosphorylation | VSDTHSRTDPIQMPY EECCCCCCCCCCCCC | 49.49 | 25072903 | |
| 109 | Phosphorylation | TDPIQMPYGDVLIHA CCCCCCCCCCEEEEC | 22.18 | 25072903 | |
| 120 | Phosphorylation | LIHAGDFTELGLPSE EEECCCCCCCCCCHH | 34.73 | 25072903 | |
| 126 | Phosphorylation | FTELGLPSEVKKFNE CCCCCCCHHHHHHHH | 61.13 | 25072903 | |
| 172 | Phosphorylation | QDFYYFPSVSKLKPE CCCCCCCCHHHCCCC | 29.17 | 26091039 | |
| 174 | Phosphorylation | FYYFPSVSKLKPENY CCCCCCHHHCCCCCH | 36.29 | 28122231 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MPPD1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MPPD1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MPPD1_HUMAN !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...