UniProt ID | MPPD1_HUMAN | |
---|---|---|
UniProt AC | O15442 | |
Protein Name | Metallophosphoesterase domain-containing protein 1 | |
Gene Name | MPPED1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 326 | |
Subcellular Localization | ||
Protein Description | May have metallophosphoesterase activity (in vitro).. | |
Protein Sequence | MWRSRWDASVLKAEALALLPCGLGMAFSQSHVMAARRHQHSRLIIEVDEYSSNPTQAFTFYNINQGRFQPPHVQMVDPVPHDAPKPPGYTRFVCVSDTHSRTDPIQMPYGDVLIHAGDFTELGLPSEVKKFNEWLGSLPYEYKIVIAGNHELTFDQEFMADLIKQDFYYFPSVSKLKPENYENVQSLLTNCIYLQDSEVTVRGFRIYGSPWQPWFYGWGFNLPRGQALLEKWNLIPEGVDILITHGPPLGFLDWVPKKMQRVGCVELLNTVQRRVQPRLHVFGHIHEGYGVMADGTTTYVNASVCTVNYQPVNPPIVIDLPTPRNS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
102 | Phosphorylation | VSDTHSRTDPIQMPY EECCCCCCCCCCCCC | 49.49 | 25072903 | |
109 | Phosphorylation | TDPIQMPYGDVLIHA CCCCCCCCCCEEEEC | 22.18 | 25072903 | |
120 | Phosphorylation | LIHAGDFTELGLPSE EEECCCCCCCCCCHH | 34.73 | 25072903 | |
126 | Phosphorylation | FTELGLPSEVKKFNE CCCCCCCHHHHHHHH | 61.13 | 25072903 | |
172 | Phosphorylation | QDFYYFPSVSKLKPE CCCCCCCCHHHCCCC | 29.17 | 26091039 | |
174 | Phosphorylation | FYYFPSVSKLKPENY CCCCCCHHHCCCCCH | 36.29 | 28122231 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MPPD1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MPPD1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MPPD1_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...