dbPTM

MPPD2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MPPD2_HUMAN
UniProt AC	Q15777
Protein Name	Metallophosphoesterase MPPED2
Gene Name	MPPED2
Organism	Homo sapiens (Human).
Sequence Length	294
Subcellular Localization
Protein Description	Displays low metallophosphoesterase activity (in vitro). May play a role in the development of the nervous system (By similarity)..
Protein Sequence	MAHGIPSQGKVTITVDEYSSNPTQAFTHYNINQSRFQPPHVHMVDPIPYDTPKPAGHTRFVCISDTHSRTDGIQMPYGDILLHTGDFTELGLPSEVKKFNDWLGNLPYEYKIVIAGNHELTFDKEFMADLVKQDYYRFPSVSKLKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIYGAPWTPWFNGWGFNLPRGQSLLDKWNLIPEGIDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVFGGIHEGYGIMTDGYTTYINASTCTVSFQPTNPPIIFDLPNPQGS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
140	Phosphorylation	QDYYRFPSVSKLKPE HCCCCCCCHHHCCHH	35.99	29759185
142	Phosphorylation	YYRFPSVSKLKPEDF CCCCCCHHHCCHHHC	36.29	29759185

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MPPD2_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MPPD2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MPPD2_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PCH2_HUMAN	TRIP13	physical	19060904
RXRG_HUMAN	RXRG	physical	25416956
PCH2_HUMAN	TRIP13	physical	25416956
VAC14_HUMAN	VAC14	physical	25416956
CAGE1_HUMAN	CAGE1	physical	25416956
FA72A_HUMAN	FAM72A	physical	25416956
NR2F6_HUMAN	NR2F6	physical	26186194
PCH2_HUMAN	TRIP13	physical	21516116
NR2F6_HUMAN	NR2F6	physical	28514442
ST1A3_HUMAN	SULT1A3	physical	28514442
ST1A4_HUMAN	SULT1A3	physical	28514442

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MPPD2_HUMAN

Related Literatures of Post-Translational Modification