UniProt ID | MPPD2_HUMAN | |
---|---|---|
UniProt AC | Q15777 | |
Protein Name | Metallophosphoesterase MPPED2 | |
Gene Name | MPPED2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 294 | |
Subcellular Localization | ||
Protein Description | Displays low metallophosphoesterase activity (in vitro). May play a role in the development of the nervous system (By similarity).. | |
Protein Sequence | MAHGIPSQGKVTITVDEYSSNPTQAFTHYNINQSRFQPPHVHMVDPIPYDTPKPAGHTRFVCISDTHSRTDGIQMPYGDILLHTGDFTELGLPSEVKKFNDWLGNLPYEYKIVIAGNHELTFDKEFMADLVKQDYYRFPSVSKLKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIYGAPWTPWFNGWGFNLPRGQSLLDKWNLIPEGIDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVFGGIHEGYGIMTDGYTTYINASTCTVSFQPTNPPIIFDLPNPQGS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MPPD2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MPPD2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MPPD2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PCH2_HUMAN | TRIP13 | physical | 19060904 | |
RXRG_HUMAN | RXRG | physical | 25416956 | |
PCH2_HUMAN | TRIP13 | physical | 25416956 | |
VAC14_HUMAN | VAC14 | physical | 25416956 | |
CAGE1_HUMAN | CAGE1 | physical | 25416956 | |
FA72A_HUMAN | FAM72A | physical | 25416956 | |
NR2F6_HUMAN | NR2F6 | physical | 26186194 | |
PCH2_HUMAN | TRIP13 | physical | 21516116 | |
NR2F6_HUMAN | NR2F6 | physical | 28514442 | |
ST1A3_HUMAN | SULT1A3 | physical | 28514442 | |
ST1A4_HUMAN | SULT1A3 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...