| UniProt ID | FA72A_HUMAN | |
|---|---|---|
| UniProt AC | Q5TYM5 | |
| Protein Name | Protein FAM72A | |
| Gene Name | FAM72A | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 149 | |
| Subcellular Localization | Cytoplasm. Mitochondrion. A V5 epitope-tagged construct has been shown to localize to the nucleus (PubMed:18676834). 5-7% of total FAM72A is associated with mitochondria around the nucleus in HEK293 cells (PubMed:21317926). | |
| Protein Description | May play a role in the regulation of cellular reactive oxygen species metabolism. May participate in cell growth regulation.. | |
| Protein Sequence | MSTNICSFKDRCVSILCCKFCKQVLSSRGMKAVLLADTEIDLFSTDIPPTNAVDFTGRCYFTKICKCKLKDIACLKCGNIVGYHVIVPCSSCLLSCNNGHFWMFHSQAVYDINRLDSTGVNVLLWGNLPEIEESTDEDVLNISAEECIR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 3 | Phosphorylation | -----MSTNICSFKD -----CCCCCCCCHH | 27.57 | 30631047 | |
| 9 | Ubiquitination | STNICSFKDRCVSIL CCCCCCCHHHHHHHH | 28.15 | - | |
| 9 (in isoform 2) | Ubiquitination | - | 28.15 | - | |
| 19 | Ubiquitination | CVSILCCKFCKQVLS HHHHHHHHHHHHHHH | 53.45 | - | |
| 22 | Ubiquitination | ILCCKFCKQVLSSRG HHHHHHHHHHHHCCC | 46.72 | - | |
| 27 | Phosphorylation | FCKQVLSSRGMKAVL HHHHHHHCCCCEEEE | 28.79 | 23532336 | |
| 63 | Ubiquitination | TGRCYFTKICKCKLK CCCEEEEEEECCCCC | 35.89 | - | |
| 70 | Ubiquitination | KICKCKLKDIACLKC EEECCCCCEEEEEEC | 32.36 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FA72A_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FA72A_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FA72A_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of FA72A_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
