dbPTM

MND1_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MND1_YEAST
UniProt AC	P53102
Protein Name	Meiotic nuclear division protein 1
Gene Name	MND1
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	219
Subcellular Localization	Nucleus .
Protein Description	Required for proper homologous chromosome pairing and efficient cross-over and intragenic recombination during meiosis. Stimulates DMC1-dependent homologous strand assimilation, which is required for the resolution of meiotic double-strand breaks..
Protein Sequence	MGPKRQTVSLQEKKNRILNFFQETYTFYNIKELEKSIPKKCGISPMIVKDLVQQMIDEDGVISVEKCGNINIYWCFKNQTLQKLYDSSELIKKKIQEVKCDIATYKQELDKTLATGRRKKFTVGQKSYNREALLEKRKKIQDEIKKKSNSLQKIESIRWDAAKIQENKQQIRLKKVHLEKTTDNIEILIDYLYKKFFLKPEQIRKEFGIPEEFKEFTEV

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of MND1_YEAST !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MND1_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MND1_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MND1_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SPO11_YEAST	SPO11	genetic	11470404
ATR_YEAST	MEC1	genetic	15120066
RED1_YEAST	RED1	genetic	15120066
HOP1_YEAST	HOP1	genetic	15120066
REC8_YEAST	REC8	genetic	15120066
HOP2_YEAST	HOP2	physical	16581767
MSH4_YEAST	MSH4	genetic	17314980
SRO9_YEAST	SRO9	genetic	17314980
PT122_YEAST	PET122	genetic	20093466
VMA21_YEAST	VMA21	genetic	20093466
COX23_YEAST	COX23	genetic	20093466
SAC1_YEAST	SAC1	genetic	20093466
UBI4P_YEAST	UBI4	genetic	20093466
COX7_YEAST	COX7	genetic	20093466
OCA2_YEAST	OCA2	genetic	20093466
RU2A_YEAST	LEA1	genetic	20093466
RTC6_YEAST	RTC6	genetic	20093466
QCR2_YEAST	QCR2	genetic	20093466
RSSA2_YEAST	RPS0B	genetic	27708008
GPR1_YEAST	GPR1	genetic	27708008
RM01_YEAST	MRPL1	genetic	27708008
PT122_YEAST	PET122	genetic	27708008
VMA21_YEAST	VMA21	genetic	27708008
SNF6_YEAST	SNF6	genetic	27708008
COX23_YEAST	COX23	genetic	27708008
THIK_YEAST	POT1	genetic	27708008
HAP4_YEAST	HAP4	genetic	27708008
RM49_YEAST	MRP49	genetic	27708008
RL22A_YEAST	RPL22A	genetic	27708008
SIC1_YEAST	SIC1	genetic	27708008
COX7_YEAST	COX7	genetic	27708008
RTC6_YEAST	RTC6	genetic	27708008
RU2A_YEAST	LEA1	genetic	27708008
VPS4_YEAST	VPS4	genetic	27708008
MAGA1_HUMAN	MAGEA1	physical	27107014

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MND1_YEAST

Related Literatures of Post-Translational Modification