UniProt ID | MND1_YEAST | |
---|---|---|
UniProt AC | P53102 | |
Protein Name | Meiotic nuclear division protein 1 | |
Gene Name | MND1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 219 | |
Subcellular Localization | Nucleus . | |
Protein Description | Required for proper homologous chromosome pairing and efficient cross-over and intragenic recombination during meiosis. Stimulates DMC1-dependent homologous strand assimilation, which is required for the resolution of meiotic double-strand breaks.. | |
Protein Sequence | MGPKRQTVSLQEKKNRILNFFQETYTFYNIKELEKSIPKKCGISPMIVKDLVQQMIDEDGVISVEKCGNINIYWCFKNQTLQKLYDSSELIKKKIQEVKCDIATYKQELDKTLATGRRKKFTVGQKSYNREALLEKRKKIQDEIKKKSNSLQKIESIRWDAAKIQENKQQIRLKKVHLEKTTDNIEILIDYLYKKFFLKPEQIRKEFGIPEEFKEFTEV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of MND1_YEAST !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MND1_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MND1_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MND1_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...