KLK8_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: KLK8_HUMAN
• UniProt AC: O60259
• Protein Name: Kallikrein-8
• Gene Name: KLK8
• Organism: Homo sapiens (Human).
• Sequence Length: 260
• Subcellular Localization: Secreted . Cytoplasm . Shows a cytoplasmic distribution in the keratinocytes.
• Protein Description: Serine protease which is capable of degrading a number of proteins such as casein, fibrinogen, kininogen, fibronectin and collagen type IV. Also cleaves L1CAM in response to increased neural activity. Induces neurite outgrowth and fasciculation of cultured hippocampal neurons. Plays a role in the formation and maturation of orphan and small synaptic boutons in the Schaffer-collateral pathway, regulates Schaffer-collateral long-term potentiation in the hippocampus and is required for memory acquisition and synaptic plasticity. Involved in skin desquamation and keratinocyte proliferation. Plays a role in the secondary phase of pathogenesis following spinal cord injury..
• Protein Sequence: MGRPRPRAAKTWMFLLLLGGAWAGHSRAQEDKVLGGHECQPHSQPWQAALFQGQQLLCGGVLVGGNWVLTAAHCKKPKYTVRLGDHSLQNKDGPEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPISLADHCTQPGQKCTVSGWGTVTSPRENFPDTLNCAEVKIFPQKKCEDAYPGQITDGMVCAGSSKGADTCQGDSGGPLVCDGALQGITSWGSDPCGRSDKPGVYTNICRYLDWIKKIIGSKG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
110	N-linked_Glycosylation	SIPHPCYNSSDVEDH CCCCCCCCCCCCCCC	41.58	UniProtKB CARBOHYD
131	O-linked_Glycosylation	LQLRDQASLGSKVKP EEHHHHHCCCCCCCC	27.85	30379171
153	Phosphorylation	TQPGQKCTVSGWGTV CCCCCCCEECCCCCC	25.41	30631047
159	Phosphorylation	CTVSGWGTVTSPREN CEECCCCCCCCCCHH	17.69	30631047

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of KLK8_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of KLK8_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of KLK8_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RGS2_HUMAN	RGS2	physical	21988832
KR103_HUMAN	KRTAP10-3	physical	25416956
NT2NL_HUMAN	NOTCH2NL	physical	25416956
ATP4A_HUMAN	ATP4A	physical	26186194
RB39B_HUMAN	RAB39B	physical	26186194
RB39A_HUMAN	RAB39A	physical	26186194
DD19B_HUMAN	DDX19B	physical	26186194
NU1M_HUMAN	ND1	physical	26186194
ARF5_HUMAN	ARF5	physical	26186194
SATT_HUMAN	SLC1A4	physical	26186194
LMF1_HUMAN	LMF1	physical	26186194
TAM41_HUMAN	TAMM41	physical	26186194
GTR8_HUMAN	SLC2A8	physical	26186194
ATP4A_HUMAN	ATP4A	physical	28514442
RB39B_HUMAN	RAB39B	physical	28514442
NU1M_HUMAN	ND1	physical	28514442
ARF5_HUMAN	ARF5	physical	28514442
MOT10_HUMAN	SLC16A10	physical	28514442
GTR8_HUMAN	SLC2A8	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.