UniProt ID | RB39A_HUMAN | |
---|---|---|
UniProt AC | Q14964 | |
Protein Name | Ras-related protein Rab-39A | |
Gene Name | RAB39A | |
Organism | Homo sapiens (Human). | |
Sequence Length | 217 | |
Subcellular Localization |
Cell membrane Lipid-anchor Cytoplasmic side . Cytoplasmic vesicle, phagosome . Cytoplasmic vesicle, phagosome membrane Lipid-anchor Cytoplasmic side. Lysosome . Recruited to phagosomes containing S.aureus or M.tuberculosis. |
|
Protein Description | Plays a role in the maturation and acidification of phagosomes that engulf pathogens, such as S.aureus and M.tuberculosis. Plays a role in vesicular trafficking. Plays a role in the fusion of phagosomes with lysosomes. Negatively regulates LPS-induced autophagosome formation in macrophages possibly by implicating PI3K. [PubMed: 24349490 May be involved in multiple neurite formation (By similarity] | |
Protein Sequence | METIWIYQFRLIVIGDSTVGKSCLLHRFTQGRFPGLRSPACDPTVGVDFFSRLLEIEPGKRIKLQLWDTAGQERFRSITRSYYRNSVGGFLVFDITNRRSFEHVKDWLEEAKMYVQPFRIVFLLVGHKCDLASQRQVTREEAEKLSADCGMKYIETSAKDATNVEESFTILTRDIYELIKKGEICIQDGWEGVKSGFVPNTVHSSEEAVKPRKECFC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
60 | Ubiquitination | LLEIEPGKRIKLQLW HHCCCCCCCEEEEEE | 62.76 | 23000965 | |
63 | Acetylation | IEPGKRIKLQLWDTA CCCCCCEEEEEECCC | 33.93 | 23954790 | |
63 | Succinylation | IEPGKRIKLQLWDTA CCCCCCEEEEEECCC | 33.93 | 23954790 | |
63 | Ubiquitination | IEPGKRIKLQLWDTA CCCCCCEEEEEECCC | 33.93 | 23000965 | |
63 | Malonylation | IEPGKRIKLQLWDTA CCCCCCEEEEEECCC | 33.93 | 26320211 | |
69 | Phosphorylation | IKLQLWDTAGQERFR EEEEEECCCCHHHHH | 22.55 | 28857561 | |
114 | Phosphorylation | WLEEAKMYVQPFRIV HHHHHHHHCCCCEEE | 8.67 | 25884760 | |
144 | Ubiquitination | VTREEAEKLSADCGM CCHHHHHHHHHHHCC | 55.58 | - | |
180 | Ubiquitination | RDIYELIKKGEICIQ HHHHHHHHCCCCEEE | 68.31 | - | |
195 | Phosphorylation | DGWEGVKSGFVPNTV CCCCCHHHCCCCCCC | 34.75 | 23312004 | |
201 | Phosphorylation | KSGFVPNTVHSSEEA HHCCCCCCCCCCHHH | 17.33 | 23312004 | |
204 | Phosphorylation | FVPNTVHSSEEAVKP CCCCCCCCCHHHCCC | 34.80 | 23312004 | |
205 | Phosphorylation | VPNTVHSSEEAVKPR CCCCCCCCHHHCCCC | 25.28 | 23312004 | |
210 | Ubiquitination | HSSEEAVKPRKECFC CCCHHHCCCCCCCCC | 46.26 | 32142685 | |
215 | Geranylgeranylation | AVKPRKECFC----- HCCCCCCCCC----- | 4.78 | - | |
217 | Geranylgeranylation | KPRKECFC------- CCCCCCCC------- | 9.13 | - | |
217 | Methylation | KPRKECFC------- CCCCCCCC------- | 9.13 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RB39A_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RB39A_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RB39A_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...