UniProt ID | RB39B_HUMAN | |
---|---|---|
UniProt AC | Q96DA2 | |
Protein Name | Ras-related protein Rab-39B | |
Gene Name | RAB39B | |
Organism | Homo sapiens (Human). | |
Sequence Length | 213 | |
Subcellular Localization |
Cell membrane Lipid-anchor Cytoplasmic side . Cytoplasmic vesicle membrane Lipid-anchor Cytoplasmic side . Golgi apparatus . Partial colocalization with markers that cycle from the cell surface to the trans-Golgi network. |
|
Protein Description | Small GTPases Rab involved in autophagy. [PubMed: 27103069 The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion] | |
Protein Sequence | MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKLQIWDTAGQERFRSITRAYYRNSVGGLLLFDITNRRSFQNVHEWLEETKVHVQPYQIVFVLVGHKCDLDTQRQVTRHEAEKLAAAYGMKYIETSARDAINVEKAFTDLTRDIYELVKRGEITIQEGWEGVKSGFVPNVVHSSEEVVKSERRCLC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
29 | Phosphorylation | SCLIRRFTEGRFAQV CHHHHHHCCCCEEEC | 35.40 | 24719451 | |
56 | Ubiquitination | LVEIEPGKRIKLQIW HEEECCCCCEEEEEE | 62.76 | 32142685 | |
65 | Phosphorylation | IKLQIWDTAGQERFR EEEEEECCCCHHHHH | 20.07 | 28857561 | |
73 | Phosphorylation | AGQERFRSITRAYYR CCHHHHHHHHHHHHH | 26.12 | - | |
92 | Phosphorylation | GLLLFDITNRRSFQN CEEEEECCCCCCCCC | 25.23 | 24260401 | |
140 | Ubiquitination | VTRHEAEKLAAAYGM HHHHHHHHHHHHHCC | 50.93 | 23000965 | |
140 | Acetylation | VTRHEAEKLAAAYGM HHHHHHHHHHHHHCC | 50.93 | 25953088 | |
162 | Ubiquitination | RDAINVEKAFTDLTR HHHCCHHHHHHHHHH | 44.51 | 29967540 | |
191 | Phosphorylation | EGWEGVKSGFVPNVV ECCHHHHCCCCCCCC | 34.75 | 23312004 | |
200 | Phosphorylation | FVPNVVHSSEEVVKS CCCCCCCCCHHHHHH | 28.03 | 27732954 | |
201 | Phosphorylation | VPNVVHSSEEVVKSE CCCCCCCCHHHHHHH | 23.93 | 27732954 | |
206 | Ubiquitination | HSSEEVVKSERRCLC CCCHHHHHHHHCCCC | 52.34 | 32142685 | |
207 | Phosphorylation | SSEEVVKSERRCLC- CCHHHHHHHHCCCC- | 25.40 | 23312004 | |
211 | Geranylgeranylation | VVKSERRCLC----- HHHHHHCCCC----- | 5.95 | - | |
213 | Methylation | KSERRCLC------- HHHHCCCC------- | 6.32 | - | |
213 | Geranylgeranylation | KSERRCLC------- HHHHCCCC------- | 6.32 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RB39B_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RB39B_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RB39B_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GOGA2_HUMAN | GOLGA2 | physical | 21516116 | |
WHAMM_HUMAN | WHAMM | physical | 28514442 | |
CL16A_HUMAN | CLEC16A | physical | 28514442 | |
TRIM4_HUMAN | TRIM4 | physical | 28514442 | |
CBL_HUMAN | CBL | physical | 28514442 | |
TRIP6_HUMAN | TRIP6 | physical | 28514442 | |
RB33B_HUMAN | RAB33B | physical | 28514442 | |
RAD50_HUMAN | RAD50 | physical | 28514442 | |
HBS1L_HUMAN | HBS1L | physical | 28514442 | |
CARM1_HUMAN | CARM1 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...