RB39B_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RB39B_HUMAN
• UniProt AC: Q96DA2
• Protein Name: Ras-related protein Rab-39B
• Gene Name: RAB39B
• Organism: Homo sapiens (Human).
• Sequence Length: 213
• Subcellular Localization: Cell membrane ; Lipid-anchor ; Cytoplasmic side . Cytoplasmic vesicle membrane ; Lipid-anchor ; Cytoplasmic side . Golgi apparatus . Partial colocalization with markers that cycle from the cell surface to the trans-Golgi network.
• Protein Description: Small GTPases Rab involved in autophagy. [PubMed: 27103069 The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion]
• Protein Sequence: MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKLQIWDTAGQERFRSITRAYYRNSVGGLLLFDITNRRSFQNVHEWLEETKVHVQPYQIVFVLVGHKCDLDTQRQVTRHEAEKLAAAYGMKYIETSARDAINVEKAFTDLTRDIYELVKRGEITIQEGWEGVKSGFVPNVVHSSEEVVKSERRCLC

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
29	Phosphorylation	SCLIRRFTEGRFAQV CHHHHHHCCCCEEEC	35.40	24719451
56	Ubiquitination	LVEIEPGKRIKLQIW HEEECCCCCEEEEEE	62.76	32142685
65	Phosphorylation	IKLQIWDTAGQERFR EEEEEECCCCHHHHH	20.07	28857561
73	Phosphorylation	AGQERFRSITRAYYR CCHHHHHHHHHHHHH	26.12	-
92	Phosphorylation	GLLLFDITNRRSFQN CEEEEECCCCCCCCC	25.23	24260401
140	Ubiquitination	VTRHEAEKLAAAYGM HHHHHHHHHHHHHCC	50.93	23000965
140	Acetylation	VTRHEAEKLAAAYGM HHHHHHHHHHHHHCC	50.93	25953088
162	Ubiquitination	RDAINVEKAFTDLTR HHHCCHHHHHHHHHH	44.51	29967540
191	Phosphorylation	EGWEGVKSGFVPNVV ECCHHHHCCCCCCCC	34.75	23312004
200	Phosphorylation	FVPNVVHSSEEVVKS CCCCCCCCCHHHHHH	28.03	27732954
201	Phosphorylation	VPNVVHSSEEVVKSE CCCCCCCCHHHHHHH	23.93	27732954
206	Ubiquitination	HSSEEVVKSERRCLC CCCHHHHHHHHCCCC	52.34	32142685
207	Phosphorylation	SSEEVVKSERRCLC- CCHHHHHHHHCCCC-	25.40	23312004
211	Geranylgeranylation	VVKSERRCLC----- HHHHHHCCCC-----	5.95	-
213	Methylation	KSERRCLC------- HHHHCCCC-------	6.32	-
213	Geranylgeranylation	KSERRCLC------- HHHHCCCC-------	6.32	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RB39B_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RB39B_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RB39B_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GOGA2_HUMAN	GOLGA2	physical	21516116
WHAMM_HUMAN	WHAMM	physical	28514442
CL16A_HUMAN	CLEC16A	physical	28514442
TRIM4_HUMAN	TRIM4	physical	28514442
CBL_HUMAN	CBL	physical	28514442
TRIP6_HUMAN	TRIP6	physical	28514442
RB33B_HUMAN	RAB33B	physical	28514442
RAD50_HUMAN	RAD50	physical	28514442
HBS1L_HUMAN	HBS1L	physical	28514442
CARM1_HUMAN	CARM1	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.