UniProt ID | GPX7_HUMAN | |
---|---|---|
UniProt AC | Q96SL4 | |
Protein Name | Glutathione peroxidase 7 | |
Gene Name | GPX7 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 187 | |
Subcellular Localization | Secreted . | |
Protein Description | It protects esophageal epithelia from hydrogen peroxide-induced oxidative stress. It suppresses acidic bile acid-induced reactive oxigen species (ROS) and protects against oxidative DNA damage and double-strand breaks.. | |
Protein Sequence | MVAATVAAAWLLLWAAACAQQEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALVRKLILLKREDL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
111 | Phosphorylation | ARRTYSVSFPMFSKI HHHHEEEECCCCCEE | 20.07 | 22210691 | |
123 | Phosphorylation | SKIAVTGTGAHPAFK CEEECCCCCCCHHHH | 23.10 | 22210691 | |
136 | Phosphorylation | FKYLAQTSGKEPTWN HHHHHHCCCCCCCCC | 35.47 | 22210691 | |
147 | Phosphorylation | PTWNFWKYLVAPDGK CCCCHHEEEECCCCC | 9.30 | - | |
162 | Phosphorylation | VVGAWDPTVSVEEVR EEEEECCCCCHHHHH | 23.96 | - | |
164 | Phosphorylation | GAWDPTVSVEEVRPQ EEECCCCCHHHHHHH | 26.70 | - | |
173 | Phosphorylation | EEVRPQITALVRKLI HHHHHHHHHHHHHHH | 14.53 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GPX7_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GPX7_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GPX7_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...