UniProt ID | PKHJ1_HUMAN | |
---|---|---|
UniProt AC | Q9NW61 | |
Protein Name | Pleckstrin homology domain-containing family J member 1 | |
Gene Name | PLEKHJ1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 149 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MRYNEKELQALSRQPAEMAAELGMRGPKKGSVLKRRLVKLVVNFLFYFRTDEAEPVGALLLERCRVVREEPGTFSISFIEDPERKYHFECSSEEQCQEWMEALRRASYEFMRRSLIFYRNEIRKVTGKDPLEQFGISEEARFQLSGLQA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
6 | Ubiquitination | --MRYNEKELQALSR --CCCCHHHHHHHHH | 61.15 | 21890473 | |
31 | Phosphorylation | MRGPKKGSVLKRRLV CCCCCCCCHHHHHHH | 32.91 | 24719451 | |
86 | Phosphorylation | IEDPERKYHFECSSE EECCCCCEECCCCCH | 20.26 | - | |
108 | Phosphorylation | EALRRASYEFMRRSL HHHHHHCHHHHHHHH | 16.52 | - | |
118 | Phosphorylation | MRRSLIFYRNEIRKV HHHHHHHHHHHHHHH | 12.92 | 17924679 | |
128 | Ubiquitination | EIRKVTGKDPLEQFG HHHHHHCCCHHHHCC | 46.97 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PKHJ1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PKHJ1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PKHJ1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
KT33B_HUMAN | KRT33B | physical | 17353931 | |
SESQ1_HUMAN | FAM109A | physical | 21900206 | |
DNM3B_HUMAN | DNMT3B | physical | 21900206 | |
CXCL7_HUMAN | PPBP | physical | 21900206 | |
A4_HUMAN | APP | physical | 21832049 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Improved titanium dioxide enrichment of phosphopeptides from HeLacells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra."; Yu L.-R., Zhu Z., Chan K.C., Issaq H.J., Dimitrov D.S., Veenstra T.D.; J. Proteome Res. 6:4150-4162(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-118, AND MASSSPECTROMETRY. |