dbPTM

SESQ1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SESQ1_HUMAN
UniProt AC	Q8N4B1
Protein Name	Sesquipedalian-1 {ECO:0000305\|PubMed:20133602}
Gene Name	PHETA1 {ECO:0000312\|HGNC:HGNC:26509}
Organism	Homo sapiens (Human).
Sequence Length	249
Subcellular Localization	Early endosome . Recycling endosome . Golgi apparatus, trans-Golgi network . Cytoplasmic vesicle, clathrin-coated vesicle . Interaction with OCRL may be crucial for targeting to endosome and to the trans-Golgi network. Also found on macropinosomes. N
Protein Description	Plays a role in endocytic trafficking. Required for receptor recycling from endosomes, both to the trans-Golgi network and the plasma membrane..
Protein Sequence	MKLNERSLAFYATCDAPVDNAGFLYKKGGRHAAYHRRWFVLRGNMLFYFEDAASREPVGVIILEGCTVELVEAAEEFAFAVRFAGTRARTYVLAAESQDAMEGWVKALSRASFDYLRLVVRELEQQLAAVRGGGGMALPQPQPQSLPLPPSLPSALAPVPSLPSAPAPVPALPLPRRPSALPPKENGCAVWSTEATFRPGPEPPPPPPRRRASAPHGPLDMAPFARLHECYGQEIRALRGQWLSSRVQP

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
26	Acetylation	DNAGFLYKKGGRHAA CCCCEEEEECCCCCE	47.27	26051181
179	Phosphorylation	LPLPRRPSALPPKEN CCCCCCCCCCCCCCC	40.40	23401153
192	Phosphorylation	ENGCAVWSTEATFRP CCCEEEEECCCEECC	15.12	32142685
213	Phosphorylation	PPPRRRASAPHGPLD CCCCCCCCCCCCCCC	40.29	30266825
226	Phosphorylation	LDMAPFARLHECYGQ CCHHHHHHHHHHHHH	36.64	32645325

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SESQ1_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SESQ1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SESQ1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
OCRL_HUMAN	OCRL	physical	20133602
PKHJ1_HUMAN	PLEKHJ1	physical	28514442
I5P2_HUMAN	INPP5B	physical	28514442
CARD9_HUMAN	CARD9	physical	28514442
OCRL_HUMAN	OCRL	physical	28514442
SPG7_HUMAN	SPG7	physical	28514442

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SESQ1_HUMAN

Related Literatures of Post-Translational Modification